KEGG   Bifidobacterium bifidum S17: BBIF_0145Help
Entry
BBIF_0145         CDS       T01328                                 

Definition
pldB Lysophospholipase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bbi  Bifidobacterium bifidum S17
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:bbi00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
152643..153698
Genome map
AA seq 351 aa AA seqDB search
MQVKLIDENRYADEMREMVLPALATCRSEGWMAPADDDGLPPLQRAGKLHYVCYDAAKFD
RLGEDGAAATFRGAVVISHGFTEFAAKYAEMVWYFLLAGYSVCVFEHRGHGYSARDVDNS
SLVWIDDWRRYVADLAKFAETVGKDYADGRPLNLYCHSMGGGIGASVLETHPTLFDKAVL
SCPMIAPVTGMPNWLASVLAAAMCRLGLGRHMVFGQSEFTPELDMADYEGASEARVRWFQ
QQRIDDPHQRTFAATFAWVRQALRLSRAVQRPEACDNVETPVLLFQAGRDVWVLNEPQNR
FAQEVNSDGGNVRVVRIENSLHEIFSMPNAVLGPYLERILGFFGSSEMPTF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtgaagcttatcgacgagaaccgctatgcagacgagatgcgcgagatggtgctg
cccgcgcttgccacatgccggtccgaaggctggatggcgccggcggacgacgacggtctg
ccgccgctgcagcgtgcgggcaaactgcattacgtgtgttacgacgcggcgaaattcgac
cggttgggcgaggacggcgccgccgccacattccgcggtgccgtggtgatctcccacggg
ttcacggagttcgccgcgaaatatgcggagatggtgtggtacttcctgctcgcagggtac
tcggtgtgcgtgttcgagcaccgcggacatgggtattccgcgcgtgacgtcgacaattcg
tccctggtgtggattgatgattggcggcggtatgtggccgatctggcgaaattcgcggag
acggtgggcaaggattacgcggatggccgtccgctgaacctgtactgccattcgatgggc
ggcggcatcggggcgagtgtgctggagacgcatccgacgctgttcgacaaggccgtgctg
tcgtgcccgatgatcgcgccggtgaccggtatgccgaactggctggcgtcggtgcttgcc
gccgcgatgtgccggctcgggctgggacggcacatggtgttcgggcagagtgagttcacg
ccggagctggatatggccgattacgagggcgcgagcgaggcccgcgtgcgctggttccaa
cagcagcgcatcgacgacccgcatcagcggacgttcgcggcgacattcgcgtgggtgcgg
caggcgctgcgactgtcgcgtgccgtgcagcggccggaggcgtgcgacaatgtcgagacg
ccggtgctgctgttccaggccgggcgcgacgtgtgggtgctcaacgagccgcagaaccgg
ttcgcgcaggaggtcaactccgatggagggaatgtgcgcgtggtacgcatcgagaactcg
ctgcatgagattttcagcatgcccaatgccgttcttgggccgtatctggagcggattctg
ggcttcttcggctcatctgagatgccgacgttctga

DBGET integrated database retrieval system