KEGG   Bifidobacterium bifidum S17: BBIF_0298Help
Entry
BBIF_0298         CDS       T01328                                 

Gene name
gltX2
Definition
gltX2 glutamyl-tRNA synthetase
Orthology
K01885  
glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
bbi  Bifidobacterium bifidum S17
Pathway
Porphyrin and chlorophyll metabolism
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bbi00860]
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:bbi00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
353950..354987
Genome map
AA seq 345 aa AA seqDB search
MNNVNRVDGMSGAADPGDADGGRGRMLLRIEDIDTPRVLPDADRWIMDDLAWLGLDWDGE
PVYQSRRLDIYEQALRALQGIDLRDAAAFGGRDGVDGTETTALIYPCFCSRADIRAASAP
QEGDRFVMYPGTCRRTLAEHPRQVEQRLANGDRHSLRIAMPVAGDARAAVTVHDRVFGNC
RFDLPRDLGDTVVRRADGLFAYQLVVTVDDLLMGVDDIVRGRDLLRSSALQLYIRERLLD
AGFGDSSDGGVAAAHRDIRFAHLPLIDNAAGRRLAKRERSLDMGTLRKHGVTAHRVIGYC
AWLLGLQQEPEPCAAADLLHGFSWDALAADSQDRSIPDDPFSIGL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
ctgaataacgtgaatcgcgtggatggcatgagtggcgcagccgatccgggcgatgcggac
ggcgggcgagggcgcatgctgctgcgcatcgaggacatcgacaccccgcgcgtgctgccg
gacgcggaccgctggatcatggacgatctggcatggttgggactggactgggatggagag
ccggtataccagtcgcggcggctcgacatctacgagcaggcgttgcgcgcgcttcagggc
attgacttgcgagacgccgccgcgttcggtggccgtgatggcgttgacggcaccgagacc
actgcgctgatatacccgtgtttctgttcgcgcgccgacatccgtgcggcctcggcgccg
caggagggcgaccgtttcgtcatgtatcccggcacatgccggcgcacgctcgccgagcat
ccgcgacaggtcgagcaacgcttggcgaatggtgatcggcattcgctgcgcatcgccatg
cccgtcgccggcgacgcgcgtgccgcggtcaccgtgcatgatcgcgtgttcgggaactgc
cgattcgatttgccgcgcgatttgggcgatacggtggtgcgacgggcggatggtctgttc
gcctatcagctggttgtcacggttgacgacttgctgatgggtgtggatgacatcgttcgc
gggcgtgacctgttgcgatcctccgcgctgcagctgtacatccgtgagcgtctgctcgac
gccggcttcggggatagctcggatggcggcgttgccgcggctcatcgcgatatccgtttc
gcacatcttccgctgatcgacaatgcggccgggcggcggctcgccaagcgtgaacggtcg
ctggatatgggaacgttacgcaaacatggcgtcacggcgcatcgggtgatcggctattgc
gcgtggctgctcggattgcagcaagagcccgagccgtgcgctgctgccgacctgttgcat
ggattttcgtgggatgcgctcgccgcagattcgcaggatcgttccatccccgacgacccg
ttcagcatcggattgtga

DBGET integrated database retrieval system