KEGG   Bifidobacterium bifidum S17: BBIF_0396Help
Entry
BBIF_0396         CDS       T01328                                 

Definition
hypothetical protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bbi  Bifidobacterium bifidum S17
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bbi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BBIF_0396
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBIF_0396
   00052 Galactose metabolism
    BBIF_0396
   00500 Starch and sucrose metabolism
    BBIF_0396
   00520 Amino sugar and nucleotide sugar metabolism
    BBIF_0396
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BBIF_0396
   00524 Butirosin and neomycin biosynthesis
    BBIF_0396
Enzymes [BR:bbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BBIF_0396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
472007..473008
Genome map
AA seq 333 aa AA seqDB search
MNDGTDEEGKLILALDVGGTKIAGSVLRFSSGHMPELIRLVQEPTQAQEGGLAVLQRIVE
FSCELLGRIGREVMGIGIGAAGVIALDGSIESATSLMPGWSGMPLGPALRAATGKTVSVV
GDVHAHALGEAHWGAGRDVSSMLLVAVGTGIGGAMVLGGHVLHGAHNVGGHIGHVCHPDA
RRIRCSCGRYGHVEPIASGLGIERCYHKLSGKDARGDRIAEMARNGDNDAQSAVLMAGRA
LGNTLGMQANMLDPEMIVLSGSVCGAGELWLDAVRQGYQDQVIDALSDIPIVPGTLGAQA
PILGAAVPLAQYLGLIEGDEGTAVEKDPICVIS
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacggaaccgatgaagagggcaaactgatactggcgttggacgtcggtggcaca
aagattgcgggtagtgtcctgcgattctcatcggggcacatgcctgagctgatccgtctg
gtacaggagcccactcaggcgcaggagggcggattggccgtgctgcagcggatcgtcgag
ttctcctgcgagttgctgggacgaatcggccgggaagtgatgggcataggtatcggtgcc
gccggtgtgattgcgctggatggttccattgaatccgcgacctcgctgatgccgggatgg
tcgggaatgcccttggggccggcattgcgagccgccaccgggaaaaccgtttccgttgtc
ggagatgtgcatgcgcacgcgctgggagaagcgcattggggtgcgggccgcgatgtctcc
tccatgctgctggtcgcggttggcacgggcatcggtggcgcgatggtgcttggcggtcat
gttctgcatggtgcccacaacgttggcggtcacataggacatgtgtgccatccggatgct
cgccgcatcaggtgttcgtgcggccggtacgggcatgtggaaccgattgcctccggactg
ggcatcgaacgttgctaccacaagctcagcggtaaggacgcaaggggcgatcgcatcgcc
gaaatggcaaggaacggtgacaatgacgcgcaatccgcagttctcatggcgggacgtgca
cttgggaataccctggggatgcaggccaacatgcttgatcctgagatgatcgtgctctcc
ggatcggtgtgcggtgccggtgagctgtggctggacgctgtgagacagggctatcaggat
caggtgatcgatgccttgtcggacattcccatagtgcccggaacactgggcgctcaggct
ccgattctgggcgcggccgttccgctggcccagtacctcggactgatcgagggcgatgaa
ggcacggctgtggagaaggatccgatatgcgtgatttcgtga

DBGET integrated database retrieval system