KEGG   Bifidobacterium bifidum S17: BBIF_0549Help
Entry
BBIF_0549         CDS       T01328                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
bbi  Bifidobacterium bifidum S17
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bbi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BBIF_0549 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    BBIF_0549 (hisD)
Enzymes [BR:bbi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     BBIF_0549 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
672676..674073
Genome map
AA seq 465 aa AA seqDB search
MSENIMRIIDLRGKNLSRAELLAAMPRAAMGTSEATDLVRPILDDVKERGAAALRDFEEK
FDHVRPEHLRVPVEAMTAALETLDPEVRAAIEESVRRARAVAANQVPKDFYTDLAEGARV
AERWIPIQRVGLYVPGGKAVYPSSVIMNAVPAQAAGVESLAIATPPARDNAEGLPNKTIL
ATCAILGVDEVYAVGGAQAIAMFAYGAKGSEPQDGDVLCDPVDKITGPGNIFVATAKSLV
SAFVGIDAVAGPTEIGIIADKTADPSLLAADLIGQAEHDELAGSVLFTDSTEIAEKVQES
LNYRVPRTEHAERVHTSLSGSQSAIVLTDSLDQSIDAANAYAAEHLEIQTADADAIVPRI
KNAGAIFRGPYSPVPLGDYMSGSNHVLPTGGTARFAAGLGVHTFMKPVEVIEYDKEGLKA
LAARINAFAVSEDLPAHGECVLSRFVKDPYDKATLREQEKEAGLR
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaacatcatgcgaatcattgatctgcggggcaagaacctgtcccgcgccgag
ttacttgccgcgatgccgcgcgccgcgatgggcacttccgaagccaccgatctggtgcgg
cctattcttgacgacgtcaaggaacgcggcgccgcggccctgcgagacttcgaggagaag
ttcgatcatgtgcgtcccgagcacctgcgcgtgccggtcgaggcgatgaccgcggcactt
gagacgcttgatcccgaagtacgcgccgccatcgaggagtccgtgcgtcgcgcacgcgcc
gtcgccgccaaccaggtgccgaaggacttttacaccgatctggccgaaggcgcccgcgtc
gccgagcgttggattccgatccagcgcgtcggtctgtacgtgcccggcggcaaggctgtc
tacccgtcttccgtgatcatgaacgccgtgccggcgcaggccgctggtgtcgagtcgctg
gccatcgccactccgcccgcacgcgacaatgcggaaggactgcccaacaagaccatcctc
gccacctgcgccatcctcggcgtcgacgaggtctacgcggtcggtggcgcccaggccatc
gccatgttcgcatacggagccaagggctccgagccgcaggacggagacgtgctgtgcgac
ccggtcgacaagatcaccggcccgggcaacatcttcgtggccaccgccaagtcgctcgtc
tccgcgttcgtgggcatcgacgcggtcgccggtcccaccgagatcggcatcatcgccgac
aagaccgccgacccgagcctgctggccgccgacctgatcggtcaggccgagcatgacgag
ctcgccggctccgtgctgttcaccgattccaccgagatcgccgagaaggttcaggagtcc
ctgaactaccgcgtgccgcgcaccgaacacgccgagcgcgttcacacgtcgctgtccgga
agccagtcggccatcgtcctgaccgacagcctcgaccagtccatcgacgcggccaacgca
tatgcggccgagcatctcgaaatccagactgccgacgcggacgccatcgtgccacgcatc
aagaacgcgggcgccatcttccgcggcccgtactccccggtgccgctgggcgattacatg
tccggctccaaccacgtgctgcccaccggcggcaccgcccgcttcgctgcgggactcggc
gtgcacacgttcatgaagcccgtcgaggtcatcgaatacgacaaggagggcctgaaggcc
ctcgccgcgcgcatcaacgccttcgccgtctccgaggacctgcccgcccacggcgagtgt
gtcctgtcgcgcttcgtcaaggatccgtacgacaaggccacgctgcgcgaacaggagaag
gaagccggtctgcgctaa

DBGET integrated database retrieval system