KEGG   Bifidobacterium bifidum S17: BBIF_0605Help
Entry
BBIF_0605         CDS       T01328                                 

Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate-lysine ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
bbi  Bifidobacterium bifidum S17
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:bbi00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    BBIF_0605
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BBIF_0605
Enzymes [BR:bbi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     BBIF_0605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(744540..746171)
Genome map
AA seq 543 aa AA seqDB search
MSRISFPRSSGLYNGSGTMRKGFGMTVTLASAAQLLKRHGLLREIIRADRWTLDAHDIEG
ADTAFSAITYDTRDVREGTLLCCKGRFKAEYLHDIDERGLAAYVADTDFSAETGAPGLIV
NDARKAMSLLSAEFYGRPQDELTVVGITGTKGKTTTAYFTQAVLNAHSHGKAALFSSVDN
CLDGHTYVESDLTTPESMDAFRMMREAADNGMKYLVMEVSSQAYKVERVYGLTFDVATFL
NISPDHISPIEHPTFEDYLYCKRQIVRNSHALVLGAASDHADLLRQDAADAGVPVTTFEL
LDGQSPAGSDAADVTASPANAEHSAYRIAADGADLGEFRLALDGDFNYANAAAALAIAHA
AGIDLTADAAATHAMEPVRIAGRMEQFHDPQSNTLAIVDYAHNYASVTALLDFVDERFGS
QHPRITLVTGSAGNKAYDRRKEIVEAAQHRIDSFIFTAEDTDTEPFIDICMEMQRYITVP
GIASTVISDRPSAVTNAIYDARAHADRFNIILIIGKGDERWIKEHNKHVPFEGDDRIVER
MFA
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgcatatcgttcccgcggtcgtcgggcttgtacaatggcagcggcaccatgagg
aaaggttttggtatgacggtaacgttggcatcggcggcgcaactgctcaagcggcacggt
ctgcttcgggagatcatccgcgcggatcgttggacgcttgatgcgcacgacatcgaaggg
gctgacaccgctttttcggcgatcacctatgacacgagggacgtgcgcgagggcacgctg
ctgtgctgcaaggggcggttcaaggccgagtatctgcatgacatcgacgagcgcgggctg
gccgcatacgtggccgacaccgatttttcggcagagaccggcgcacccggcctgatcgtc
aatgacgcgcgcaaggccatgagcctgctgtccgcggagttctacggacgtccgcaggac
gagctgaccgtggtcggcatcaccggcaccaagggcaagactacgaccgcgtacttcacc
caggccgtgctgaacgcccactcgcacggcaaggcagcgctgttctcctccgtggacaac
tgcctggacgggcacacgtacgtcgagtccgacctgaccacgcccgagtcgatggacgct
ttccgcatgatgcgagaggccgctgacaacggcatgaagtacctcgtcatggaggtctcc
tcgcaggcgtacaaggtcgagcgcgtgtacgggctgacgttcgacgtggccacgttcctg
aacatctcccccgaccatatcagcccgatcgagcatccgacgttcgaggattacctgtat
tgcaagcgccagatcgtgcgcaacagccacgcgctggtgcttggcgcggccagcgatcat
gccgacctgctgcgtcaggacgcggcggacgccggcgtgccggtcaccacgttcgagctg
ctggacgggcagagccccgccggatccgatgccgccgatgtcaccgcaagcccggcgaac
gccgagcacagcgcctaccgtatcgccgcagacggcgctgatctcggcgagttccgtctg
gcgttggacggcgacttcaactacgccaacgcggcagcggcgctggccatcgcgcatgcc
gccggaatcgacctgaccgccgacgccgcggccacgcacgcgatggagccggtgcgcatc
gccggccgcatggagcagttccacgacccgcagtccaacacgctggcgatcgtcgactac
gcgcacaactacgcctccgtgaccgcgctgctcgatttcgtcgacgagcggttcggctcg
cagcacccgcgcatcacgcttgtcaccggctcggccggcaacaaggcgtacgaccggcgc
aaggagatcgtcgaagcggcgcagcatcgcatcgacagcttcatcttcaccgccgaggac
acggacaccgaaccgttcatcgacatctgcatggagatgcaacggtacatcaccgtgccc
ggcatcgcgtccaccgtcatctccgaccgcccgagcgccgtcacgaacgcgatctacgac
gcccgagcgcacgccgaccggttcaacatcatcctcatcatcggcaagggtgacgaacgc
tggatcaaggagcacaacaagcacgtgccgttcgagggcgacgaccgcatcgtcgaacgc
atgttcgcctga

DBGET integrated database retrieval system