KEGG   Bifidobacterium bifidum S17: BBIF_0893Help
Entry
BBIF_0893         CDS       T01328                                 

Gene name
pyrB
Definition
(GenBank) Aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bbi  Bifidobacterium bifidum S17
Pathway
bbi00240  Pyrimidine metabolism
bbi00250  Alanine, aspartate and glutamate metabolism
bbi01100  Metabolic pathways
Module
bbi_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:bbi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BBIF_0893 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BBIF_0893 (pyrB)
Enzymes [BR:bbi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     BBIF_0893 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ADO53098
UniProt: E3EM91
Position
1088737..1089732
Genome map
AA seq 331 aa AA seqDB search
MSVTEEPAETPLVGQSVITLDTLSISQIRDLLHKAAYIDANRKRVAHTCDGRVLATLFYE
PSTRTRLSFETAMLRLGGQVIGFAGAQLASVSKGESIADTLKTVSNYVDVVAIRHPKEGA
ALVASRAASVPVINAGDGGHMHPTQTLADLATLQSRFGRVTDLTIGLCGDLTFGRTVHSL
IETLCRFGNVRFVLISPDELKTPRYVIDRIKATPSCSYVEVKDLVSVIGDLDVLYMTRVQ
QERFFNEDDYLRLRDTYILDEDKLSKAKPSMAVLHPLPRINEIAVEVDADPRAAYFEQVK
NGMLMRMALESSLVGDQLPGYEPLDPKEVQA
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagtcacagaggagccggcggagacgccgttggtcggtcaaagcgtcatcacgctg
gatacgctttccatttcccagattcgagatttgctgcacaaggcggcatacatcgatgcg
aaccgcaaacgcgtggcgcatacctgcgacggcagggtgttggccacgcttttttatgag
cccagcacgcgcactcgcctgagcttcgagaccgccatgctgcgtctcggcggccaggtc
atcgggttcgccggcgcgcagctcgcctcggtgtccaagggcgagtccatcgccgacacg
ctcaagaccgtgtccaactacgtggacgtggtcgccatccgccatccgaaggagggagcg
gcgctggtcgcctcgcgcgccgcgtccgtgcccgtgatcaacgcgggcgacggcggccac
atgcaccccacgcagacgctcgccgacttggcgacgctgcaatcgcgcttcggtcgtgtc
accgacctgaccatcggcctgtgcggcgatctgacgttcggccgcaccgtgcattcgctg
atcgagacgctgtgccgcttcggcaacgtgcgtttcgtgctgatcagccccgacgagctc
aagaccccgcgctatgtgatcgaccgcatcaaggcgacgccgtcctgctcctacgtggag
gtcaaggacctcgtctccgtgatcggcgacctcgacgtgctgtacatgacccgcgtgcag
caggagcgcttcttcaacgaggatgactacctgcgtctgcgcgacacgtacatcctcgac
gaggacaagctctccaaggccaagccgagcatggccgtgctgcacccgctgccgcgcatc
aacgagatcgccgtcgaggtcgacgctgacccgcgcgccgcctacttcgagcaggtcaag
aacggcatgctcatgcgtatggcattggaaagctcactggtcggagaccagctgccggga
tatgagccgctcgaccccaaggaggttcaggcctga

DBGET integrated database retrieval system