KEGG   Bifidobacterium bifidum S17: BBIF_0901Help
Entry
BBIF_0901         CDS       T01328                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bbi  Bifidobacterium bifidum S17
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bbi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BBIF_0901
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBIF_0901
  Lipid metabolism
   00071 Fatty acid degradation
    BBIF_0901
  Amino acid metabolism
   00350 Tyrosine metabolism
    BBIF_0901
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BBIF_0901
   00626 Naphthalene degradation
    BBIF_0901
Enzymes [BR:bbi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BBIF_0901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1095703..1096746
Genome map
AA seq 347 aa AA seqDB search
MIEMMKAAIFVEPGKMTVEEVPKATLRQDDDIVIRVVRTCVCGSDLWFFRGLSRQAAHSQ
VGHESIGVVEEVGAAVESVKPGDFVVVPFPYSCGKCPVCKAGFESVCPHGGYFSACQAEY
LRVPEADGTVVKVPGSSEDYDDATLASLLTISDVMSTGYHAAASADVKPGDTAVVMGDGA
VGLCGVIAAKMRGATRIIAMSRHEDRAALAREFGATDIVPERDQAAVDKVLGMTGGYGAD
AVLECVGSKQSFDTAIGLIRRGGVIGRVGLPHDVVISAEGTFYGNIGIKGGPAPVRHYDL
DDGLLDAVLKGEINPGRVFTAEYDLDHIQDAYEAMDQRKVIKALIRL
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaatgatgaaggctgcgatattcgtggagcccggcaagatgaccgtcgaggag
gtgccgaaggcgacgcttcggcaggacgacgacatcgtgattcgcgtggtgcgcacttgc
gtgtgcggttccgatttgtggttcttccgtgggctgagcagacaggccgcacacagccag
gtgggtcacgagtccatcggtgtggtcgaagaggttggcgcggcggtcgaatccgtcaag
cccggcgacttcgtggttgtgccgttcccgtacagttgcggcaagtgcccggtgtgcaag
gccggctttgaatccgtgtgcccgcacggcggctacttctccgcctgtcaggccgaatac
ctgcgcgtaccggaggcggacggcaccgtggtcaaggtgcccggttcgtcggaagactac
gacgacgcgacgctcgcttcgctgctgaccatttccgatgtgatgtccaccggttatcac
gcggcagcttctgccgatgtcaagcccggtgacaccgccgtggtcatgggcgatggcgca
gttggcctgtgcggtgtgattgccgccaagatgcgcggtgccacgcgcattattgccatg
agccgtcacgaggatcgcgcggcgctcgcccgcgaattcggtgcgactgatatcgtgccc
gagcgcgatcaggccgccgtcgacaaggtgctggggatgaccggcggctatggtgccgac
gctgtgctcgaatgcgtgggctccaagcagtccttcgacacggcgatcggtctgatccgt
cgtggtggcgtgatcggccgcgtgggcctgccgcatgatgtagtaatcagcgccgaaggc
acgttctacggcaacatcggcatcaagggcggcccggctcccgtgcgccactatgacctc
gatgacggtctgctggatgcggtgctcaagggcgaaatcaaccccggtcgcgtgttcacc
gccgagtacgacctcgaccacatccaggacgcctatgaggccatggaccagcgcaaggtg
attaaggcgctgattcgcctctag

DBGET integrated database retrieval system