KEGG   Bifidobacterium bifidum S17: BBIF_0924Help
Entry
BBIF_0924         CDS       T01328                                 

Gene name
ugpA
Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bbi  Bifidobacterium bifidum S17
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bbi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BBIF_0924 (ugpA)
   00052 Galactose metabolism
    BBIF_0924 (ugpA)
   00500 Starch and sucrose metabolism
    BBIF_0924 (ugpA)
   00520 Amino sugar and nucleotide sugar metabolism
    BBIF_0924 (ugpA)
Enzymes [BR:bbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BBIF_0924 (ugpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1116408..1117874
Genome map
AA seq 488 aa AA seqDB search
MFAEDLKRTEKMTVDDVFEQSAQKMREQGMSEIAISQFRHAYHVWASEKESAWIREDTVE
PLHGVRSFHDVYKTVDHDKAVHAFAKTAFLKLNGGLGTSMGLQCAKSLLPVRRHKARQMR
FLDIILGQVLTARTRLNVPLPVTFMNSFRTSDDTMKALRHQRKFKQTDIPLEIIQHQEPK
IDAATGAPASWPANPDLEWCPPGHGDLFSTLRESGLLDTLLEHGFEYLFISNSDNLGARP
SRTLAQYFEDTGAPFMVEVANRTYADRKGGHIVRDTATGRLILREMSQVHPDDKDAAQDI
AKHPYFNTNNIWVRIDVLRDMLAEHDGVLPLPVIINNKTVDPTDPQSPAVVQLETAMGAA
IGLFEGAICVQVDRMRFLPVKTTNDLFIMRSDRFHLTDSYEMEDGNYIFPNVDLDPRYYK
NIEDFNERFPYNVPSLAAANSVSIKGDWTFGRDVIMFADARLEDRNEPSYVPNGEYVGPM
GIEPGDWV
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgtttgccgaagatctgaaacggacggagaagatgacagtggacgatgtgttcgagcag
tcggcgcagaagatgcgcgagcagggcatgagcgagatcgccatctcgcagttcaggcac
gcataccatgtgtgggccagcgagaaggagagcgcgtggatccgcgaggacaccgtcgag
ccgctgcacggcgtgcggagcttccatgacgtgtacaagaccgtcgatcatgacaaggca
gtgcacgcgttcgccaagaccgcattcctcaagctcaacggcggcctgggaacctcgatg
ggcctgcaatgcgcgaagtcgctgctgccggtgcgccgccacaaggctcggcagatgcgc
ttcctcgacatcatcctcggtcaggtgctcaccgcgcgcacgaggctgaacgtgcctctg
ccggtcacgttcatgaactcgttccgcacttcggatgacacgatgaaggcactgcgacac
cagcgcaagttcaagcagaccgacatcccgctggagatcatccagcatcaggagccaaag
atcgacgcggccaccggagcgccggcgtcttggccggccaaccccgatctggagtggtgc
ccgcccggccacggcgacctgttctcgacgctgcgggagtccggcctgctggacactctg
ctggagcatggcttcgaatacctgttcatctcgaactccgacaatctgggggcgcgcccg
tctcgcacgctcgcccagtatttcgaggacacgggcgccccgttcatggtcgaggtcgcc
aatcgcacgtacgcggaccgcaagggtggccatatcgtgcgcgacacggccaccggccga
ctgatcctgcgggagatgtcgcaggtgcatcccgacgacaaggacgcggcccaagacatc
gccaagcacccgtatttcaacacgaacaacatctgggtgcgcatcgacgtgctgcgcgac
atgctcgccgagcatgacggcgtgctgccgcttcccgtcatcatcaacaacaagaccgtc
gacccgaccgacccccagtccccggcggtggtccagctggagaccgcgatgggcgcggcg
atcggcctgttcgaaggcgcgatctgtgtgcaggtggaccgcatgcggttcctgccagtg
aagacgaccaacgacctgttcattatgcgttccgatcggttccaccttacggactcgtat
gagatggaggacggcaactacattttcccgaacgtcgacctcgatccgcggtactacaag
aacatcgaggacttcaacgaacggttcccctacaacgtgccgtcgctcgccgccgcgaac
tcggtcagcatcaagggagactggacattcggacgtgacgtcatcatgttcgccgacgcg
cgtctggaggatagaaacgagcccagttacgtacccaacggcgaatacgtcggaccgatg
ggcatcgagcccggtgattgggtgtga

DBGET integrated database retrieval system