KEGG   Bifidobacterium bifidum S17: BBIF_0946Help
Entry
BBIF_0946         CDS       T01328                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bbi  Bifidobacterium bifidum S17
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bbi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BBIF_0946 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BBIF_0946 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BBIF_0946 (trpA)
Enzymes [BR:bbi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BBIF_0946 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1135267..1136145)
Genome map
AA seq 292 aa AA seqDB search
MIMTNTATTPSGQPLGISHKPSATEAMFDRLKAENKPAFIGYLPYGFPNPDISLDALRIM
VEHGVDAVEIGLPYSDPVMDGPVIQAASQIALNNGESINGVFKAVETVANAGGVPLIMSY
WNLIYHYGVERFACDFENAGGAGLITPDLIPDEAGEWIEASDRHGLDRIFLVSPDSASER
LELVARNARGFVYAASRMGVTGERDTISASPETLVERARNAGARNVCVGIGVSTPEQGAK
VGAYADGVIVGSALVHTLLDDDNVTAKAPKEGLRDLAAKVEALSEGIHNESR
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
ttgattatgacgaatacagcaaccacgccgtccggacagccgctcggcatcagtcacaag
cccagcgcgacggaagccatgttcgaccggctcaaggccgaaaacaagccggccttcatc
ggatacctgccgtatggcttcccgaaccccgacatctcactcgacgcgctcaggatcatg
gtcgagcacggcgtcgacgcggtcgagatcggcctgccgtactccgacccggtgatggac
ggccccgtcattcaggcggccagccagatcgccctgaacaacggggaaagcatcaacggc
gtgttcaaggcggtcgagacggtggccaacgccggcggcgtgccactcatcatgagctac
tggaacctgatctaccattacggcgtcgaacggttcgcctgcgatttcgagaacgccggc
ggtgccggcctgattacccccgacctcatccccgatgaggctggcgagtggatcgaggct
tcggatcgtcacggactcgaccgcatcttcctggtctccccggattcggcctccgaacgt
ctcgaactggtcgcccgcaacgcacgcggcttcgtctacgcggcatcccgtatgggcgtc
accggcgagcgcgacactatcagcgcatcgcccgaaacgcttgtcgagcgtgcccgcaac
gccggggcgagaaacgtgtgcgtgggtatcggcgtatccaccccggagcagggcgcgaag
gtcggcgcctacgccgacggcgtcatcgtcggttctgctctggtgcacaccctgcttgac
gacgacaacgtcaccgcgaaggcgccgaaggaaggactgcgcgacctggccgccaaggtc
gaggcgctgtccgagggcatccacaacgagtcacgctga

DBGET integrated database retrieval system