KEGG   Bifidobacterium bifidum S17: BBIF_0946Help
Entry
BBIF_0946         CDS       T01328                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bbi  Bifidobacterium bifidum S17
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bbi01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bbi00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:bbi00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1135267..1136145)
Genome map
AA seq 292 aa AA seqDB search
MIMTNTATTPSGQPLGISHKPSATEAMFDRLKAENKPAFIGYLPYGFPNPDISLDALRIM
VEHGVDAVEIGLPYSDPVMDGPVIQAASQIALNNGESINGVFKAVETVANAGGVPLIMSY
WNLIYHYGVERFACDFENAGGAGLITPDLIPDEAGEWIEASDRHGLDRIFLVSPDSASER
LELVARNARGFVYAASRMGVTGERDTISASPETLVERARNAGARNVCVGIGVSTPEQGAK
VGAYADGVIVGSALVHTLLDDDNVTAKAPKEGLRDLAAKVEALSEGIHNESR
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
ttgattatgacgaatacagcaaccacgccgtccggacagccgctcggcatcagtcacaag
cccagcgcgacggaagccatgttcgaccggctcaaggccgaaaacaagccggccttcatc
ggatacctgccgtatggcttcccgaaccccgacatctcactcgacgcgctcaggatcatg
gtcgagcacggcgtcgacgcggtcgagatcggcctgccgtactccgacccggtgatggac
ggccccgtcattcaggcggccagccagatcgccctgaacaacggggaaagcatcaacggc
gtgttcaaggcggtcgagacggtggccaacgccggcggcgtgccactcatcatgagctac
tggaacctgatctaccattacggcgtcgaacggttcgcctgcgatttcgagaacgccggc
ggtgccggcctgattacccccgacctcatccccgatgaggctggcgagtggatcgaggct
tcggatcgtcacggactcgaccgcatcttcctggtctccccggattcggcctccgaacgt
ctcgaactggtcgcccgcaacgcacgcggcttcgtctacgcggcatcccgtatgggcgtc
accggcgagcgcgacactatcagcgcatcgcccgaaacgcttgtcgagcgtgcccgcaac
gccggggcgagaaacgtgtgcgtgggtatcggcgtatccaccccggagcagggcgcgaag
gtcggcgcctacgccgacggcgtcatcgtcggttctgctctggtgcacaccctgcttgac
gacgacaacgtcaccgcgaaggcgccgaaggaaggactgcgcgacctggccgccaaggtc
gaggcgctgtccgagggcatccacaacgagtcacgctga

DBGET integrated database retrieval system