KEGG   Bifidobacterium bifidum S17: BBIF_0947Help
Entry
BBIF_0947         CDS       T01328                                 

Gene name
trpBC
Definition
(GenBank) TrpB/TrpC bifunctional protein, includes tryptophan synthase beta chain and indole-3-glycerol phosphate synthase
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bbi  Bifidobacterium bifidum S17
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bbi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BBIF_0947 (trpBC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BBIF_0947 (trpBC)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BBIF_0947 (trpBC)
Enzymes [BR:bbi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BBIF_0947 (trpBC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1136172..1138259)
Genome map
AA seq 695 aa AA seqDB search
MSVLDELVAGALEDQRSRECVVSLEDVRRAALAAPAPIDATRWLKRPDGIPVIAEIKRAS
PSKGHLSDIPDPAALAREYERGGANAISVLTEGRRFLGSLDDFDKVRSAVHIPLLRKDFI
VTDYQIYEARAHGADLVLLIVAALDDDKLAHLLELAHELGMAVLVETHTTEEIRRAVAAG
ARIIGINARNLKNLKVDVNKYAELAEGLPDDVIRVAESGVFGSVEVEDYGRAGADAVLVG
EGVATADDHVAAVQRLVKAGQRVKASESTPLSEHQGPYWGQFGGRYVPEALITALDELER
VYDQAKADPEFRKEFMTLQHRYVGRPSPLTEAPRFAALVKDRTGLDARIFLKREDLNHTG
AHKINNALGQALLVKRMGKTRVIAETGAGQHGVATATVCAMLGLKCRVYMGQIDARRQAL
NVARMRMLGAEVVEVTLGDKILKDAINEALRDWVTNVADTHYLLGTVAGPHPFPAMVRDF
QKIIGEEAKQQLQDWYGIDHPDAVCACVGGGSNAIGVMNAFLDDERVNLYGYEAGGNGPS
SGHHAIRFAPGTGQLGMFQGAKSYLLETDEGQTLDTYSISAGLDYASVGPEHAWLKEIGR
VNYSWATDEEAMNAFRDLSQTEGIIPAIESSHAVAGAFKAAADLKAKGYDKAVMIVNISG
RGDKDMATAGKWFGYLTDEQAAALDVTGAQGDTVA
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgtcggttttggacgaattggttgccggggcgttggaagaccagcgttcccgtgaatgt
gtcgtgtctcttgaggatgtgaggcgggccgctctggccgcgccggcgcctatcgacgcg
acgcgatggctcaagcgtccggacggcatccccgtgatcgccgaaatcaagcgcgcctcc
ccatccaaggggcatttgagcgatatccccgacccggcggccctggcccgcgaatacgag
cgcggcggtgcgaacgcgatttccgtgctcaccgaaggccggcggttcctcggctcgctg
gacgatttcgacaaggtccgctcggcggttcacattcctctgctgcgcaaggacttcatc
gtcaccgactaccagatctacgaggcgcgtgcccacggcgccgacctagtgctgctcatc
gtcgccgcgctggacgacgacaagctcgcgcacctgcttgaactcgcccacgagctcggc
atggccgtgctcgtcgaaacgcacaccaccgaggagatccgccgcgcggtcgcggccggc
gcccggatcatcggcatcaacgcgcgcaatctcaagaacctgaaggttgacgtgaacaaa
tacgccgaactcgccgaaggactgcccgatgacgtgatccgcgtcgcagagtcgggcgtg
ttcggttcggtcgaggtcgaggattacggtcgcgccggcgcggatgccgtgctggtgggc
gaaggcgtggctaccgccgacgaccatgtggccgccgtacaacgactagtaaaggcaggt
cagagagtgaaagcatccgaatcgaccccgttgagcgagcatcagggaccatattgggga
cagttcggcgggcgatacgtgccggaggcactgatcaccgctctggacgagctggagcgc
gtctatgatcaggccaaggccgaccccgagttccgtaaggaattcatgacgctgcagcat
cggtacgtcggccgtccgagcccgctgacggaagccccgcgattcgccgcgctggtcaag
gacaggaccggactcgacgcccgcatcttcttgaagcgcgaggacctcaaccacaccggc
gcgcacaagatcaacaacgcgctcggccaggcgttgctcgtcaagcgcatgggcaagacc
cgcgtgatcgccgagaccggtgccggacagcacggcgtggccaccgccaccgtgtgcgcg
atgctagggctcaagtgccgcgtgtacatggggcagatcgacgcccgacgtcaggccctc
aacgtggcccgcatgcgcatgctgggcgccgaggtcgtcgaagtgacactgggcgacaag
attctcaaggatgcaatcaacgaggcgctgcgcgattgggtgaccaacgtcgccgatacg
cactacctgctcggcacggtcgccggaccgcacccgttcccggccatggttcgcgacttc
cagaagatcatcggcgaggaggccaagcagcaacttcaggactggtacggcatcgaccac
ccggacgcggtgtgcgcgtgcgtcggcggcggatccaacgccatcggcgtgatgaacgcg
ttcctcgacgacgagcgcgtgaacctgtacggctatgaggcgggcggcaacgggccgtcc
tcgggccatcatgcgatccgtttcgcaccgggcaccggacagctcggcatgttccagggt
gccaagagctacctgttggagaccgatgaaggacagactctcgacacgtattcgatttcg
gccggtctcgattacgcttccgtcggccccgagcacgcttggctcaaggagatcgggcgc
gtgaactactcctgggccaccgacgaggaggctatgaacgccttccgcgacctgagccag
accgagggcatcatccccgccatcgagagctcgcatgccgtcgctggcgccttcaaggcc
gccgctgatctgaaggccaagggatacgacaaggccgtgatgatcgtcaacatctccggc
cgcggcgacaaggacatggccaccgcgggcaaatggttcggatacctgaccgacgagcag
gccgcggcgctcgatgtcaccggcgcgcagggcgacaccgtcgcctga

DBGET integrated database retrieval system