KEGG   Bifidobacterium bifidum S17: BBIF_0981Help
Entry
BBIF_0981         CDS       T01328                                 

Gene name
tpi
Definition
Triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bbi  Bifidobacterium bifidum S17
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bbi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BBIF_0981 (tpi)
   01230 Biosynthesis of amino acids
    BBIF_0981 (tpi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBIF_0981 (tpi)
   00051 Fructose and mannose metabolism
    BBIF_0981 (tpi)
   00562 Inositol phosphate metabolism
    BBIF_0981 (tpi)
Enzymes [BR:bbi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BBIF_0981 (tpi)
Exosome [BR:bbi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BBIF_0981 (tpi)
  Exosomal proteins of bladder cancer cells
   BBIF_0981 (tpi)
  Exosomal proteins of melanoma cells
   BBIF_0981 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1179019..1179813)
Genome map
AA seq 264 aa AA seqDB search
MASRIPLLAGNWKMNLDHLEATYFVQKLVWLLRDARFDYSRCEIALMPSFTSLRSVQVLV
EADKLKIRYGAQAVSVTTQGAFTGDVSADMIAHLGCSYVIVGHSERRKYHPEDDVNIVDQ
VRAVLAAGMQPILCVGESFEERRQGIELDFAVGQVHDVTRDLSDKEAAKLIIAYEPVWAI
GTGMVATPDTAQQAAKAIRDDLGEMFGPAVADTVRILYGGSVSSKNATHLIGEPDVDGFL
IGGASLDPDELAKIARLTLKATRR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcacgcatcccgctgctcgcgggcaattggaagatgaacctcgaccatcttgag
gccacgtatttcgtgcagaaactcgtatggctgcttcgtgacgcacgcttcgactactcc
cgctgcgaaatagccctgatgccgtcgttcacgtcgctgcgcagcgtccaggtgctggtc
gaagccgacaagctcaagatccgctacggcgcgcaggccgtgtcggtgaccacacagggt
gcgttcaccggcgatgtctccgctgacatgatcgcgcatctcggctgctcgtacgtcatc
gtcgggcattccgaacgccgcaagtaccatcccgaagacgacgtcaacattgtcgatcag
gtgcgtgccgtattggcggccggcatgcagccgatactgtgcgtcggagaaagcttcgag
gaacgccgccagggcatcgagctcgacttcgccgtcggacaggtgcatgacgtgacccgt
gacctttccgacaaggaggccgcgaagctcatcatcgcgtacgagccggtctgggcgatc
ggcaccggcatggtcgccactccggacaccgcccagcaggccgccaaagccatccgcgac
gacctcggcgagatgttcggccccgccgtcgccgatactgtgcgcatcctatacggcgga
tcggtgtcgtccaagaacgcgacgcatctgatcggcgagccggatgtcgacggattcctg
atcggcggcgcgtcgctcgaccccgacgaattggcgaagatcgcccggttgacactcaag
gcgacacgtcgatag

DBGET integrated database retrieval system