KEGG   Bifidobacterium bifidum S17: BBIF_1032Help
Entry
BBIF_1032         CDS       T01328                                 

Gene name
gpm3
Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bbi  Bifidobacterium bifidum S17
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bbi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BBIF_1032 (gpm3)
   01230 Biosynthesis of amino acids
    BBIF_1032 (gpm3)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBIF_1032 (gpm3)
  Energy metabolism
   00680 Methane metabolism
    BBIF_1032 (gpm3)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BBIF_1032 (gpm3)
Enzymes [BR:bbi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BBIF_1032 (gpm3)
Exosome [BR:bbi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BBIF_1032 (gpm3)
  Exosomal proteins of melanoma cells
   BBIF_1032 (gpm3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1242840..1243676)
Genome map
AA seq 278 aa AA seqDB search
MIDEVVFLRHGRTAFNVARRLQGQIDVPLDIIGQWQADQSASELARRYYWAKVANIARHP
DTLAQPGPGAAKSSDTEEYRQVPASSRRMVVVSSDLFRALQTAHAFADMLGLDVTADARL
RERSFGQWEGMTRDEIRAEHADAYDSWRVHTGGELAFGVESRTATGLRGADAVLDLVRGI
NAEHADEPTTLMLVGHGSWHVATIETLLGMDPDNLSNLDGMRNAFWSTLRPVYRPSGGVE
WMMTAFNQGPAVAALCDWENGPQSLHGPHMPMWKPIEG
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgattgacgaagtggtgtttctgcggcacggacggaccgccttcaatgtggcgaggcgg
ttgcaggggcagatcgacgtgcccctcgatatcatcggccagtggcaggccgaccagagc
gcgtcggagcttgcgcgacgctactactgggcgaaggtggccaacatcgcccggcatccg
gatacgctggcccagccggggccgggggcggcgaaatccagcgacaccgaggaataccgg
caggtccccgcatcctcgcgacgcatggtcgtcgtctcgtccgacctgttccgcgcgttg
cagaccgcgcacgcgttcgccgatatgctggggctggacgtgaccgcggacgcgcgcctg
cgcgaacgcagcttcgggcagtgggagggcatgacccgcgacgagattcgagcggagcat
gccgacgcctatgattcgtggcgggtccacaccggcggcgagctcgcgttcggcgtggag
agccgcaccgccacaggactgcgcggcgccgatgcggtgctcgacctggtgcgcggcatc
aacgcggagcatgccgatgagccgaccaccctgatgctcgtcgggcacggctcatggcat
gtggccacgatcgagaccctgctcggcatggaccccgacaacctgagcaacctggatggc
atgcgcaacgcgttctggtcgacgctcagaccggtataccggccttcgggcggcgtcgaa
tggatgatgacggcgttcaaccaggggccggcggtcgctgctctgtgcgattgggagaac
ggcccgcagtccctgcacggcccgcacatgccgatgtggaagccgatcgaggggtga

DBGET integrated database retrieval system