KEGG   Bifidobacterium bifidum S17: BBIF_1062Help
Entry
BBIF_1062         CDS       T01328                                 

Gene name
gpm4
Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bbi  Bifidobacterium bifidum S17
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:bbi01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bbi01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bbi00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:bbi00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bbi00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1274374..1275111)
Genome map
AA seq 245 aa AA seqDB search
MPAKLMSDVSSPQAMPEHVRSITLIRHGRTSYNARHCFQGQIDIPLDEIGEWQVRQTAQA
LRSLYVESHPERRQLVVASDLSRAMATAHAFADPLGLVVHPDARVRERNFGEWEGKELAE
LERECPEDYRAWAEYRGGELRHGAETKAAVGERGRAALEEWSFSAGADTDLYVFSHGSWI
AQTVQTVLGLGAIHPDFADVVSMANAHWVRFVAADMPDGTLRWRLVDYNHGPAPADTDQW
EHPSL
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgccggcgaagctgatgagtgacgtctcctcgccgcaggcgatgccggagcacgtccgc
tccatcacgctgatacggcatgggcgcacctcatacaacgcccggcattgcttccagggg
cagattgacatccccttggatgagatcggcgaatggcaggtcaggcagaccgcgcaggca
ctgcgctccctatacgtcgaatcgcacccggaacgccggcagctcgtcgtggcatccgac
ctgagtcgtgccatggccacggcgcacgccttcgccgacccgctcggactggtcgtgcac
cccgacgcccgcgtgcgggagcgcaacttcggcgaatgggaaggcaaggagctggccgaa
ctggagcgcgaatgccctgaggactaccgtgcatgggcggaatatcgcggtggcgaactg
cggcatggtgccgagacgaaggccgccgtcggcgagcgaggccgcgcggcattggaggaa
tggtcgttcagcgccggagccgacacggatctgtacgtgttctcgcatggctcatggatc
gcgcagaccgtgcagaccgtgctgggattgggggctatccaccccgatttcgccgacgtg
gtcagcatggccaacgcgcactgggtgcggttcgtcgcagccgacatgcccgacggcacg
ttgcggtggcggctcgtcgactacaatcatggtccggcgcccgccgacaccgaccagtgg
gagcatccgtccctatag

DBGET integrated database retrieval system