KEGG   Bifidobacterium bifidum S17: BBIF_1369Help
Entry
BBIF_1369         CDS       T01328                                 

Gene name
glk2
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bbi  Bifidobacterium bifidum S17
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bbi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BBIF_1369 (glk2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBIF_1369 (glk2)
   00052 Galactose metabolism
    BBIF_1369 (glk2)
   00500 Starch and sucrose metabolism
    BBIF_1369 (glk2)
   00520 Amino sugar and nucleotide sugar metabolism
    BBIF_1369 (glk2)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BBIF_1369 (glk2)
   00524 Butirosin and neomycin biosynthesis
    BBIF_1369 (glk2)
Enzymes [BR:bbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BBIF_1369 (glk2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1651522..1652472
Genome map
AA seq 316 aa AA seqDB search
MTTLAIDIGGTKIAAAVCDENDAITHRWRVPTPMDADAINHHIANIYHEAVAAGHDDIQA
IGISAAGNVGADRRTLTFAANIPAWINYDLSEHIGALIDHAVPVVVENDANCAGWGEYVH
GAGQGSSNMVALTVGTGLGGAIVIDGRLYRGSFGMAAELGHLPMVPDGDTCGCGLRGCAE
RYTSGSALERFAKSAVRRRPQDAERLMELCGGDVDKLEGPMVSQAAQEGDVLGLYAFGKI
GEWLGRAMAATAAVLDPDVFVIGGGVVAVGDILLEPARYNYQRFLEGSAYRGHASIVAAT
AGQDAGLIGAANLALR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgctagccattgatatcggaggaaccaaaatcgccgcagccgtatgcgatgaa
aacgatgccatcacacatcgctggcgcgttcccacaccgatggacgccgacgccatcaac
caccacatcgccaacatctaccatgaggccgtcgccgccggccacgacgacatccaggcc
atcggcatctccgcggccggcaacgtcggcgcggaccgccgcaccctcaccttcgccgcg
aacatccccgcgtggatcaactacgacctgtccgagcacatcggcgcgctcatcgaccat
gccgtgccggtcgtcgtcgagaacgacgccaactgcgccggctggggcgaatacgtgcac
ggtgcgggccagggcagctcgaacatggtcgcgctgaccgtaggtaccggactgggcgga
gcaatcgtcatcgacgggcggctgtaccgcggatcgttcggcatggccgcggaactcgga
cacctgccgatggtgccggacggcgacacctgcggatgcgggcttcgcggctgtgcggaa
cgctacacgtctggaagcgcgctggaacggttcgccaagtccgccgtgcgccgacgcccg
caggacgccgaacgcctgatggagttgtgcggcggcgacgtcgacaagctcgaaggcccg
atggtctcgcaggccgcacaggagggcgacgtgctcggcctgtacgccttcggcaaaatc
ggcgaatggctcggccgcgcgatggccgccaccgccgcggtgctcgacccggacgtcttc
gtgatcggcggtggcgtagtggcggtcggcgacatcctgctggagccggcgcgatacaac
taccagcggttcctggagggcagcgcataccgtggccacgcgagcatcgtcgccgccacc
gccggacaggacgccggcctgatcggcgccgccaacctggcactgcgctaa

DBGET integrated database retrieval system