KEGG   Bifidobacterium bifidum S17: BBIF_1382Help
Entry
BBIF_1382         CDS       T01328                                 

Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
bbi  Bifidobacterium bifidum S17
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BBIF_1382
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BBIF_1382
Enzymes [BR:bbi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BBIF_1382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1665014..1668352)
Genome map
AA seq 1112 aa AA seqDB search
MEKSSNRRFGVRTVAAIVAGLMVGGMCTAMTASAADDSAAGYSATAPVNLTRPATVPSMD
GWTDGTGAWTLGEGTRVVSSDALAARAQSLASELTKFTDVDIKAATGSATGKDISLTLDA
SKKAELGDEGFKLNIGSKGLEVIGATDIGVFYGTRSVSQMLRQGQLTLPAGTVATKPKYK
ERGATLCACQINISTDWIDRFLSDMADLRLNYVLLEMKLKPEEDNTKKAATWSYYTRDDV
KKFVKKANNYGIDVIPEINSPGHMNVWLENYPEYQLADNSGRKDPNKLDISNPEAVKFYK
TLIDEYDGVFTTKYWHMGADEYMIGTSFDNYSKLKTFAEKQYGAGATPNDAFTGFINDID
KYVKAKGKQLRIWNDGIVNTKNVSLNKDIVIEYWYGAGRKPQELVQDGYTLMNATQALYW
SRSAQVYKVNAARLYNNNWNVGTFDGGRQIDKNYDKLTGAKVSIWPDSSIYQTENEVEKE
IFDGMRFISQMTWSDSRPWATWNDMKADIDKIGYPLDIREYDYTPVDAGIYDIPQLKSIS
KGPWELITTPDGYYQMKDTVSGKCLALFTGSKHLDVVTQVGATPELRNCADVSVGQDQRD
TANERNTQKWQIRADKDGKYTISPALTQQRLAIATGNEQNIDLETHRPAAGTVAQFPADL
VSDNALFTLTGHMGMSATVDSKTVNPASPSKITVKVRAASNANTGDVTVTPVVPEGWEIK
PGSVSLKSIPADKAAIAYFNVVNTTGTGDATVQFKLTNTKTGEELGTTSVALTGSLTKDV
EASDYAASSQETTGEHAPVGNAFDKNANTFWHSKYSNPSANLPHWLAFKASPGEGNKIAA
ITHLYRQDKLNGPAKNVAVYVVAASDANSVADVTNWGEPVATAEFPYTKELQTIALPNTI
PSGDVYVKFQINDAWGLTETSAGVTWAAVAELAATAKATPVELTEPEQPKDNPEVTETPE
ATGVTVSGDGVANGALSLKKGTTAQLTAKVAPDDADQAVTWASSDDKVVTVDKTGKVTAV
AKGVAKVTATTANGKSASVTVTVTEDSEVPGPTGPTEPTKPGTEKPTTKPTTKPNDGKLS
ATGADTAVLATIAALFALAGGAVVAVRRRSVR
NT seq 3339 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaagctccaatagacgtttcggtgtgcgtaccgttgcggccattgtagccggc
ctgatggtcggtggcatgtgcaccgcgatgacggccagcgccgccgacgatagtgcagcc
gggtacagtgccacggctcccgtgaatctcacccgcccggccaccgtcccgagcatggac
ggctggaccgacggcaccggcgcatggacgctgggtgaaggcacccgcgtcgtgtcgagc
gatgcactggccgcgcgtgcgcagagcctggcatccgagctgaccaagttcaccgacgtg
gacatcaaggccgcgaccggttcagcgacgggcaaagacatctcgctcacgttggatgca
tcgaagaaggccgaactgggtgatgagggattcaagctgaacatcggctcgaagggcctt
gaggtcatcggcgcgaccgacatcggcgtgttctacggcacccgttccgtctcgcagatg
cttcgccagggccagctgaccctgcccgccggcacggtcgccacgaagccgaagtacaag
gagcgcggcgctacgctgtgcgcctgccagatcaacatctccactgactggatcgaccgt
ttcctgtcggacatggccgacctgcgcctcaactacgtgctgctggagatgaagctcaag
ccggaagaggacaacaccaagaaggccgccacatggtcgtactacacgcgcgacgacgtc
aagaagttcgtcaagaaggcgaataactacggcatcgacgtgattccggagattaactcc
ccgggccacatgaacgtctggctggagaactacccggagtaccagcttgccgacaactca
ggccggaaggatcccaacaagctcgacatctccaacccggaggccgtgaagttctacaag
acgctgattgacgaatacgacggcgtattcaccacgaaatactggcacatgggcgccgac
gagtacatgatcggcaccagcttcgacaactacagcaagttgaagacgttcgccgaaaag
cagtacggagccggcgcgacaccgaatgatgcgttcaccggcttcatcaatgacatagat
aaatacgtcaaggccaagggcaagcagctgcgcatctggaacgacggcatcgtcaacacc
aagaacgtctccctgaacaaggacatcgtcatcgaatactggtatggtgccggccgcaag
ccgcaggagctcgtccaggacggatacacgttgatgaacgcgacccaggccctgtactgg
tcccgttcggcgcaagtgtacaaggtcaacgccgcaagactgtacaacaacaactggaac
gtcggaacctttgacggcggacgacagatcgacaagaactacgacaaactgaccggtgcg
aaggtgtccatctggcccgacagctcgatctaccagaccgagaacgaggtcgagaaggag
atcttcgacggcatgcgcttcatctcacagatgacctggtccgattcccgcccgtgggcg
acgtggaacgatatgaaggcggacatcgacaagatcggctacccgctggacatccgcgaa
tacgactacaccccggtcgatgccggcatctacgacatcccccagttgaagtcgatctcc
aaaggtccgtgggagctcatcaccacgcctgacggctactaccagatgaaggatacagtg
tccggaaagtgtcttgcgctcttcaccggaagcaagcatctcgatgtcgtcacccaggtc
ggcgcgacgccggaactgcgcaactgcgccgacgtgtccgtcggtcaggatcagcgcgac
accgccaatgagcgtaacacgcagaagtggcagatccgcgccgacaaggatggcaagtac
accatctccccggcgctgacgcagcagcgtctcgccatcgccaccggcaacgagcagaac
atcgatctggagacccatcgtcccgccgctggcaccgtcgctcagttcccggctgacctg
gtcagcgacaacgcgctgttcacgctcaccggccacatgggcatgtccgccaccgtggac
tccaagaccgtgaacccggcctccccgtccaagatcaccgtcaaggtgagggccgcatcc
aacgcgaacaccggtgacgtcaccgtcaccccggtcgtgccggaaggctgggagatcaag
cccggaagcgtcagcctcaagtcgattccggccgacaaggccgccatcgcctacttcaac
gtggtcaacaccactgggacgggcgacgccaccgtgcagttcaagctcaccaacaccaag
accggtgaagagctcggcaccaccagcgtggcgctgaccggcagcctgaccaaggacgtg
gaagcaagcgactacgcggcgagctctcaggagaccaccggcgagcatgctcccgtgggc
aacgccttcgacaagaacgcaaacacgttctggcacagcaagtactccaaccccagcgcc
aatcttccgcactggctggcgttcaaggcgtcgcccggcgagggcaacaagattgcggcc
atcacccacctgtaccgtcaggacaagctgaacggcccggccaagaacgtcgcagtgtac
gtggtggcggccagcgacgccaacagcgttgccgatgtcaccaactggggtgaacccgtc
gccacggctgagttcccgtacaccaaggaactgcagaccatcgcgctgccgaataccatt
ccgtccggtgacgtgtacgtcaagttccagatcaacgacgcatggggcctcaccgaaacc
agcgcaggcgtcacctgggcggctgtcgccgagctggctgcgacggccaaggccactccg
gtcgagctcaccgagcccgagcagccgaaggacaaccccgaggtgacggagactccggag
gctacgggtgtgaccgtttctggcgatggtgttgccaatggcgcgctgtcgctgaagaag
ggcaccaccgcgcagctgaccgcgaaggtcgcgccggatgacgcggaccaggcggtgacg
tgggcctccagcgatgacaaggtcgtgacggtcgacaagaccggcaaggtgaccgccgtc
gcgaagggcgtggcgaaggtgaccgcgaccacggcgaacggcaagtccgcctctgtgacc
gtcaccgtcaccgaggactctgaggtgcccggcccgactggcccgaccgagccgaccaaa
ccgggtacggagaagccgaccacgaagccgaccacgaagccgaacgacggcaagctcagc
gccaccggcgccgacacggcggtgctcgccaccatcgcggctctgttcgcgctggccggc
ggtgcggtcgtcgcggttcgtcgccgcagcgtccgctga

DBGET integrated database retrieval system