KEGG   Bifidobacterium bifidum S17: BBIF_1385Help
Entry
BBIF_1385         CDS       T01328                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
bbi  Bifidobacterium bifidum S17
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bbi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BBIF_1385 (folK)
Enzymes [BR:bbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     BBIF_1385 (folK)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.25  dihydroneopterin aldolase
     BBIF_1385 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1670701..1672215)
Genome map
AA seq 504 aa AA seqDB search
MDTIRLTGVQGMGTHGVLDYEHQRAQPFIVDAVLHLDLSRAGSSDDLHDTVDYGRVAKRI
VSVIEGEHVDLIERLAALIADAVIADHPAVQGVTVTVHKPKAPITVPFADVSVTIERWRS
GRNTDGKTGRADEGRVTPMHHAVIALGGNKGDVAASMRSAIADIDGLEGTQVTGISPLYR
TAAWGMPDGTPDFLNAVIEVTTELDAASLLGRLQHIEVAHGRTREQHWASRTLDLDIIDV
DGLVSEDPNVTLPHPRAWQRAFVLAPWLALDPAARLAGPHGGEIADLLHEAGDREDVHRI
DDSWMTGMADDAPVQPSGSAADIPQFDGTVDGSARKPGDGDTATVQPAIHTAVISMDSRS
NEAETLFRTAIVALEGIPGDQVEGISPLYHVSHLHGSDAMSAVMQMTCRMDAKALIATLG
SVEESLNGDVDLDLVDMPGTVCDEPDCRVPWPSARTHASVLAPWMDMDPQARLGGDPVSY
LLAMAPDADRVGLLSDTWIVGSTE
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
gtggacacgattcgcctcaccggcgttcaaggcatgggcacgcacggcgtgctggactac
gagcaccagcgcgcgcagcccttcatcgtcgatgccgtgctgcatctcgacctgtcacgt
gccggttccagcgatgacctgcatgacacggttgattacgggcgcgtcgccaaacggatc
gtatccgtcatcgaaggcgagcatgtcgacttgattgagcggctggcggctctcatcgct
gacgccgtgatagccgaccatcccgcagtccaaggcgtaaccgtcaccgtgcataagccc
aaagctccgatcaccgtgccgttcgccgacgtgagcgtcaccatcgagcgatggcggagc
ggacggaatacggacggcaaaactggtcgagctgatgaaggccgtgtcacgcccatgcac
cacgccgtgatcgcactcggcggcaacaagggcgacgtcgcggcgtcgatgcggtccgcg
atcgcggatatcgacggccttgaaggcacacaggtgactgggatatcgccgttgtaccgc
accgccgcatggggcatgccggatggtaccccggattttctcaacgctgtcatcgaggtc
acgaccgagctggacgcggcgagtctgcttggccgcctgcagcatatcgaagttgctcat
ggacgcacgcgggaacaacattgggcgtcgcgcacactggatcttgacatcatcgatgtc
gatggcctcgtcagcgaggacccgaatgtgactttgccgcatccgcgtgcgtggcagcgg
gcgttcgttttggcaccgtggctggctcttgatccggccgcccggctcgcgggcccgcac
gggggagagattgccgatttgctgcacgaggccggtgaccgcgaggacgtacatcgcatc
gacgacagttggatgaccggcatggccgacgatgccccggtgcagccgtccggcagcgca
gccgacataccgcaattcgatggaaccgtcgacggttcggcgcggaaaccgggtgacggc
gataccgctaccgttcaaccggccatacatacggccgtcatctcgatggacagtcgcagt
aacgaggccgaaaccctgttccgcacggcgattgtcgcattggagggcattcccggtgat
caggtcgagggcatctcaccgctgtatcatgtgagccatctgcatgggtcggatgccatg
tcggctgtcatgcaaatgacgtgccggatggacgcgaaggcgctgattgccacgctcggt
tccgtcgaggagtcgttgaacggggatgtcgacctcgatctggtggatatgccgggaacg
gtctgcgatgagccggactgccgggtgccgtggccgtcagcccgcacccatgcttcggtg
ctcgcaccgtggatggacatggacccgcaggcgcggctcggcggcgacccggtgtcgtat
ctgctggccatggcacccgacgccgaccgtgtgggactgctgtccgacacttggatcgta
gggagtacggaatga

DBGET integrated database retrieval system