KEGG   Bifidobacterium bifidum S17: BBIF_1406Help
Entry
BBIF_1406         CDS       T01328                                 

Gene name
lacZ3
Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
bbi  Bifidobacterium bifidum S17
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bbi00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bbi00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:bbi00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1694719..1697877
Genome map
AA seq 1052 aa AA seqDB search
MNTTDDQRKNGDPIVSPSIPTTAWLADPRVYAVHRLDAHSDHACWSRSPVDGESTNLRQS
LDGEWRVRVETAPTGRFPDGTSDGPDWISDVSPLFAAPGFDDSSFSRVQVPSHLETAGLL
APQYVNVQYPWDGHEDPKAPAIPEHGHVAVYRREFDADGEVAQAVREGRPVTLTFQGAAT
AIYVWLNGSFVGYAEDSFTPSEFDVTDAIKVDGNVLAVVCYEYSSASWLEDQDFWRLHGL
FRSVELNARPAAHIADLHADADWDLATSRGSLSLDVLIDGAANAATADFALWDKNGTIVW
HTATKADGTLHAEAEIDDAAPWSAERPDLYELSVTLLDADGKVLETARTRIGFRHVAIED
GILKLNGKRLVFRGVNRHEFDCRRGRAITEEDMLWDIRFMKRHNINSVRTSHYPNQSRWY
ELCDEYGIYLIDETNLETHGSWNSPGDIPVGTSVPGDDEAWLGACIDRLDSMILRDRNHP
SVLVWSLGNESYAGEVLKAMSAHAHRLDPGRPVHYEGVNWNHAYDGISDFESRMYAKPAE
IQDWLEHGDERGEASKPFVSCEYMHAMGNSCGGLSEFIDLERYERYSGGFIWDYIDQGLV
QRLPDGSERLSVGGEWGDRPTDYEFVGNGIVFADRTPSPKAQEVKQLYSPVKLAPDGHGV
TIENRNLFAGTDGYVFAARLLEDGHEIWHADYRFDVAAGDTQHHDIAFPDIDADGDTREV
TYEVDLLLAEATAWAPAGYELAFGQLTGTLNPEQDITETSHDDDGRATRTLSRWNAGIRR
DDEEILLSRTQGGIVSWKRDDREMVIRRPELVTFRPLTDNDRGNHSGFDRAAWFAAGRYA
IVTETKIHESDDGLVAEYQYELADPNHTPVSVTYHVNSDMRMQLTVEYPGNATDMASLPA
FGIEWELPGEYDRLRYYGPGPEETYRDRKQGGKLGIWDATAKASMAPYLMVQETGSHEDV
RWLEATDIQGHGLRVTQRGDRHFTASLLPWNTYMIEAARRHEDLPEPRHNYLRLLAAQMG
VGGDDSWGAPVHTAYQLPAGRPLTLDVNLELI
NT seq 3159 nt NT seq  +upstreamnt  +downstreamnt
atgaacacaaccgacgatcagcggaagaacggcgatccgatcgtctccccgtccataccg
acgacggcatggctcgccgacccgcgcgtgtacgcggttcaccggctcgacgcccattcc
gatcatgcgtgctggtctcgctccccagtcgacggcgagagcacgaatctcaggcagagc
cttgacggcgaatggcgggtccgcgtcgagacggcgccgacgggccgtttccccgatggg
acgagcgacgggccggactggatcagcgacgtgtcgcctctgttcgccgcgcccggattc
gacgattcgtcgttctcacgcgtgcaggtgccctcgcatctggagactgcggggctgctt
gccccgcagtacgtgaacgtgcagtacccatgggacggacatgaggacccgaaggccccg
gccatccccgagcatggccatgtggcggtctaccggcgcgagttcgacgcggatggcgaa
gtcgcccaggccgtgcgcgaagggcgcccggtgacgcttaccttccagggcgcggccaca
gccatctacgtgtggctcaacggctcgttcgttggctacgccgaggactccttcacgccc
agcgagttcgacgtgacggacgcgatcaaggtggacggcaacgtgctggcggtcgtctgc
tacgagtattcgagcgcgagctggttggaggatcaggacttctggcgtctgcacggcctg
ttccgctccgtcgaactcaacgcgaggcccgccgcccacatcgccgacctccatgccgac
gccgactgggatctcgccacatcaaggggttcgctctcgctggatgtgctgatcgacggt
gccgcgaacgccgcgacggccgacttcgcactgtgggacaagaacggcaccatcgtctgg
cacaccgccacgaaagcggacggaacgctgcacgccgaggccgagatcgatgacgcggcg
ccatggagcgccgaacgccccgacctgtacgagctatccgtcaccctgctcgacgcggac
ggcaaggtcctggagaccgctcgcactcgcatcggcttccggcatgtggccatcgaggac
ggcatcctcaagctcaacggcaagcgcctcgtgttccgtggcgtcaaccgccacgagttc
gactgccggcgcggccgggccatcaccgaagaggacatgctgtgggacatccgcttcatg
aagcgccacaacatcaactcggtgcgcacctcgcactatccgaaccagtcgcgctggtac
gagctgtgcgacgaatacggcatctacctgatcgacgagaccaatctggagacccatggc
agctggaacagccccggcgacatccccgtgggaacctccgtccccggtgacgacgaggcc
tggctgggcgcgtgcatcgaccggctggacagcatgatcctgcgcgaccgcaaccatccc
agcgtgctcgtctggtcgctgggcaacgaatcctacgcgggcgaagtcctcaaggccatg
agcgcgcacgcgcaccggcttgatccgggtcgtcccgtccactacgaaggtgtcaactgg
aaccatgcctacgacgggatcagcgacttcgaaagccgtatgtacgccaagccggccgag
atccaagactggctcgaacacggcgacgaacggggcgaggcgagcaagccgttcgtcagc
tgtgagtacatgcatgccatgggcaactcgtgcggcggtctgagcgagttcatcgacctc
gaacggtacgagcgctactccggcgggttcatctgggattacatcgaccaggggctcgtc
cagcgtctgcccgacgggagcgaacgcctcagcgtcggcggagaatggggcgaccgtcca
accgactacgaattcgtgggcaacggcatcgtgttcgccgaccgcacgcccagccccaag
gcgcaggaggtcaagcagctgtattcgccggtcaagctcgcccccgacgggcacggcgtg
accatcgagaaccgcaacctgttcgccggcaccgacggctacgtgttcgccgcacggctc
ctcgaagacgggcatgagatctggcatgccgactaccgtttcgacgtggccgcaggagat
acccaacaccatgacatcgccttcccggacatcgacgcggacggggatacgcgcgaagtc
acctacgaggtcgatctcctgctcgccgaagccaccgcatgggcgccggccggctacgag
ctcgcgttcggccaactcaccggcacgctcaaccccgaacaggacatcaccgagaccagc
catgacgacgacggccgcgcaactcgcacgctcagccgatggaacgccggcatccgccgc
gacgacgaggaaattctcctgtcacgcactcagggaggcatcgtctcctggaagcgcgac
gaccgggaaatggtcatccgtcgccccgaactcgtcacgttccgcccattgaccgacaac
gatcgcggtaaccattccggtttcgaccgtgccgcatggttcgcggccggccgatacgcc
atcgtaaccgaaacgaaaatccatgaaagcgatgacggtctcgtagcggaataccagtac
gagcttgccgatccgaaccacacgcccgtgtccgtcacttaccatgtcaactccgatatg
cgtatgcaactgaccgtcgaataccccgggaacgccactgacatggccagtctgcccgcg
ttcggtatcgaatgggagctgcccggcgaatacgatcgtctgcgctactacggccccggc
cccgaggagacctaccgcgaccgtaagcagggcggcaagctcggcatctgggacgccacc
gcgaaggcgagcatggcgccgtatctcatggtgcaggaaaccggcagccacgaggacgtc
cgctggctcgaagccaccgacatccaaggccacggattgcgcgtcacccaacgcggcgac
cgtcacttcacggccagcctgctgccctggaacacctacatgatcgaggccgcacgccgc
cacgaggacctgcccgaaccgcgccacaactacctgcgcctgctcgcggcccagatgggc
gtcggcggagacgactcctggggagcccccgtccacacggcctaccagctgcccgccggc
aggccgctcactctcgacgtgaacctcgaactcatctga

DBGET integrated database retrieval system