KEGG   Bifidobacterium bifidum S17: BBIF_1509Help
Entry
BBIF_1509         CDS       T01328                                 

Gene name
adh3
Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
bbi  Bifidobacterium bifidum S17
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bbi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BBIF_1509 (adh3)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBIF_1509 (adh3)
   00620 Pyruvate metabolism
    BBIF_1509 (adh3)
   00650 Butanoate metabolism
    BBIF_1509 (adh3)
  Lipid metabolism
   00071 Fatty acid degradation
    BBIF_1509 (adh3)
  Amino acid metabolism
   00350 Tyrosine metabolism
    BBIF_1509 (adh3)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BBIF_1509 (adh3)
   00626 Naphthalene degradation
    BBIF_1509 (adh3)
Enzymes [BR:bbi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BBIF_1509 (adh3)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BBIF_1509 (adh3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1814874..1817606)
Genome map
AA seq 910 aa AA seqDB search
MAEATQVEAPAKPSPEEKRAAAEAEVDALVKKGLKALDEFEKLDQKQVDRIVAKASVAAL
NKHLVLAKMAVDETGRGLVEDKATKNIFACEHVTHYMAGQKTVGLIREDEVMGIDEVAEP
VGVVAGVTPVTNPTSTAIFKSLLALKTRCPIVFGFHPGAQKSSVAAAKIVRDAAIEAGAP
ENCVQWIEHPSIEATGALMKHPGIATILATGGPGMVKAAYSSGKPALGVGAGNAPAYIDT
DVDIERAANDLILSKHFDYGMICATEQAIIAHKDVYAPLVKELKRRKAYFVNADEKAKLE
QYMFGCTAGSGQKPVLNSVVPGKSPQFIAKAAGFEIPADATILAAECKEVSDDEPLTHEK
LAPVQAVLKADDKEQAFEMCEKMLKLGAGHTAAIHTNNEALVREYGLRMHACRIIWNQPS
SLGGIGDIYNAIAPSLTLGCGSYGGNSVSGNVQAVNLINIKRIARRNNNMQWFKIPAKTY
FEPNAIKYLRDMHGIEKAVIVCDKVMEQLGIVDKVIDQLRARDNRVTFRIIDYVEPEPSV
ETVERGAEMMREEFEPDTIIAVGGGSPMDAAKIMWLLYEHPEISFSDVREKFFDIRKRAF
RIPPLGEKAKLVCIPTSSGTGSEVTPFAVITDHKTGYKYPITDYALTPSVAIVDPVLART
QPRKLASDAGFDALTHSMEAYVSVYANDFTDGMALHAAKLIWDNLAESVNGEPGLAKTDA
QEKMHNAATMAGMAFGSAFLGMCHGMAHTIGALCHIAHGRTNSILLPYVIRYNGAVPEEP
TSWPKYNKYVADKRYQDIARIIGIDPGKTPAEGVENLAKAVEDYRDNKLGMNKSFQDCGV
EEDYFWSVLDQIGMRAYEDQCTPANPRIPMIEDMKDIAVAAYYGVPQAEGHKIRVEREGV
AATEEASERV
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagcaacacaggtcgaggcgcccgccaagccgagtcccgaggagaagcgcgcg
gcggccgaagccgaggtcgacgcccttgtcaagaagggtctcaaggcccttgacgagttc
gagaagctcgatcagaagcaggttgaccgcatcgtcgccaaggcgtccgtcgcggccctg
aacaagcatctggtgctcgcgaagatggccgtcgatgagaccggccgtggtctcgtcgaa
gacaaggccaccaagaacatcttcgcctgcgagcacgtcacccactacatggccgggcag
aagaccgtcggcctgatccgcgaggacgaggtcatgggcatagacgaggtcgccgagccg
gtcggcgtcgtcgccggtgtcaccccggtcacgaacccgacctccaccgccatcttcaag
tcgctgctggcactcaagacccgctgtccgatcgtgttcggcttccacccgggcgcccag
aagtcgtccgtggccgccgcgaagatcgtccgcgacgccgcgatcgaagcaggcgcaccc
gagaactgcgtgcagtggatcgaacacccgtccatcgaggcgaccggcgcgctgatgaag
cacccgggcatcgccaccatcctggccaccggcggccccggcatggtcaaggccgcgtac
tcctccggcaagcccgccctcggcgtcggcgccggcaacgctccggcctacatcgatacc
gatgtggacatcgaacgtgcggcgaacgacctgatcctctccaagcacttcgattacggc
atgatctgcgccaccgagcaggccatcatcgcccacaaggacgtctacgcgccgctcgtc
aaggagctcaagcgccgcaaggcatacttcgtcaacgcggacgagaaggcgaagctggag
cagtacatgttcggctgcaccgccggctccggccagaagccggtcctcaactccgtggtg
ccgggcaagtccccgcagttcatcgccaaggccgccggcttcgagatccccgccgacgcg
acgatcctcgccgccgaatgcaaggaggtctccgacgacgagccgctgacccacgagaag
ctcgccccggtgcaggccgtgctcaaggccgacgacaaggagcaggccttcgagatgtgc
gagaagatgctcaagctcggtgccggccacaccgccgccatccacacgaacaacgaggcg
ctggtgcgcgagtacggcctgcgcatgcacgcctgccgcatcatctggaaccagccgagc
tcgctcggcggcatcggcgacatctacaacgcgattgccccgtcgctgaccctgggctgc
ggctcctacggcggcaactcggtgtccggcaacgtccaggccgtgaacctgatcaacatc
aagcgcatcgctcggaggaacaataacatgcagtggttcaagattccggccaagacgtac
ttcgagccgaacgccatcaagtacctgcgcgacatgcacggcatcgagaaggccgtcatc
gtgtgcgacaaggtgatggagcagctcggcatcgtcgacaaggtcatcgaccagctgcgc
gcccgtgacaatcgcgtcaccttccgaatcatcgactacgtcgagccggagccctccgtc
gagaccgtcgagcgcggcgccgagatgatgcgcgaggagttcgagcccgacacgatcatc
gcggtcggtggcggctccccgatggacgcggccaagatcatgtggctgctctacgagcac
ccggaaatctccttctccgacgtgcgtgagaagttcttcgacatccgcaagcgcgcgttc
cgtatcccgccgctgggcgagaaggccaagctcgtgtgcatcccgacctcgtcgggcact
ggttcggaggtgacgccgttcgccgtgatcaccgaccacaagaccggatacaagtacccg
atcaccgactacgcgctgaccccgtccgtggccatcgtggacccggtgctggcccgcacc
cagccgcgcaagctggcctccgacgccggcttcgacgccctgacccattccatggaagcc
tacgtgtccgtgtacgcgaacgacttcaccgacggcatggccctgcacgcggccaagctc
atctgggacaacctggccgagtccgtcaacggcgagccggggctcgccaagaccgacgcg
caggagaagatgcacaacgccgccaccatggccggcatggcgttcggctccgcgttcctc
ggcatgtgccacggcatggcccacaccatcggcgccctgtgccacatcgcccacggccgc
accaactccatcctgctgccgtacgtgatccgctacaacggtgccgtcccggaggagccg
accagctggccgaagtacaacaagtacgtcgccgacaagcgctaccaggacatcgcccgc
atcatcggcatcgacccgggcaagaccccggccgaaggcgtcgagaatctggcgaaggcc
gtcgaggactaccgcgacaacaagctcggcatgaacaagtccttccaggactgcggcgtg
gaagaggactacttctggagcgtgctcgaccagatcggcatgcgcgcttacgaggaccag
tgcaccccggccaacccgcgcatcccgatgatcgaggacatgaaggacatcgccgtggcc
gcatactacggcgtgccgcaggccgaaggccacaagattcgcgtcgagcgcgagggtgtg
gccgccaccgaagaggcgtccgagcgcgtctga

DBGET integrated database retrieval system