KEGG   Bifidobacterium bifidum S17: BBIF_1514Help
Entry
BBIF_1514         CDS       T01328                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bbi  Bifidobacterium bifidum S17
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bbi00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1823120..1825288)
Genome map
AA seq 722 aa AA seqDB search
MTESTESAERLARPLIHLARLVGLATSYIGMSDDYHEIDDDVLKALLGALGVDAHDDDAI
DDSVVRILRERHGRLVAPTVLHVVGKEDRVLLNTGIMQIPSATITLENGDEYQGALEPGA
GDGSQAYEVDGKFVATASITIPADLPMGYHTLHVSVGDRTQDATLISAPERIPMLPAMEH
DQLWGWMAQLYSIRSAGSWGVGDFEDLKTLMVDSHSKTGADFMLVNPLHACEPVAPLTPS
PYLPISRRFINFTYIRPEAIEEYAGLGDDLKSQIGELHAQAEPLNGDAQIIDRDSMWRVK
MHALWLIFKAGRSEERQKAFDDYKSTSAEGLEAYATWCLCYDKWGAPTGEADSWEKRLDK
NSDEVQGLRRQFPDTLDFYRWLEWIADEQLGAAQQAAKDAGMQIGLMADMAVGVHPSGSD
VWWNPECFAKGATVGAPPDYFNQQGQDWSQPPLNPIELENTGYLTYRHMVQGMFAHAGAV
RIDHILGLFRLWWIPSGRTPKDGAYVQYDSEIMLGILALEASRAHGVVVGEDLGVVPDHV
STSLSAHQVLGCAVEWFEQMDGKFRAPKDWREFSLASVNTHDLPPAAGYLAYEHVELRER
LGLIEGSVEDFEQNARAEHKAMMVMLIVNGYLDPDLLKDEKAHEQEIVEALYRGLRGSPC
KLLAASIVDGVGELRAQNQPGTNNEYPNWRIPLADGKGNVVPLEELFSNTRLLSLAKVMQ
GR
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgacagagagtacagaaagtgcggagcgtctcgcgcgtccgctgatccatctggcgcgt
ctggttggattggccacgagctacatcggcatgagcgacgactatcacgagatcgatgat
gatgtcctgaaggcgttgctgggtgcgttgggcgtggacgcccatgacgatgacgccatc
gatgattccgttgtccgtatccttcgcgagcgccacgggcgtctcgtcgccccgaccgtg
ttgcatgtcgtcggcaaggaagatcgtgtgctgctcaacaccggtatcatgcagattccc
tccgcaaccatcacgctggaaaacggcgacgaataccagggtgcgctggagccgggagcc
ggagacggatcgcaggcgtacgaggtcgacggcaagttcgtggcgacggcatccatcacc
atacccgcggatctgccgatgggataccatacgctgcatgtcagcgtgggcgaccgcacg
caggacgccacgctgatcagcgcccccgagcgtattccgatgctgccggccatggaacat
gaccagctgtggggctggatggcccagctgtattccatccggtccgccggatcctggggc
gtgggtgatttcgaggacctcaagaccctcatggtcgattcgcacagcaagaccggcgcc
gatttcatgctggtcaacccgctgcacgcgtgcgagccggtagcgccgctcaccccgtcg
ccgtacctgccgatttcccgccgcttcatcaacttcacgtacattcgtcccgaggcgatc
gaggaatatgccggcctcggcgatgacctgaaatcgcagatcggcgagctgcacgcgcag
gccgaaccgctgaacggggacgcgcagattatcgaccgtgattcgatgtggcgcgtgaag
atgcacgccctgtggctgatttttaaggccggacgcagcgaggagcgtcagaaggcgttc
gacgactacaagagcacgtccgccgaagggcttgaggcctacgccacgtggtgcctgtgc
tacgacaagtggggcgcgccgaccggcgaagccgacagctgggagaagcgcctcgacaag
aacagcgacgaggtgcaggggctgcgtcgacagttccccgacacattggacttctaccgc
tggttggaatggatcgccgatgagcagctgggagccgctcagcaggccgcgaaggacgcc
ggcatgcagatcggcctcatggccgacatggcggtcggtgtgcatccgtctggctccgac
gtgtggtggaacccggagtgtttcgccaagggcgccacggtcggcgcgccgccggattac
ttcaaccagcaggggcaggactggagccagccgccactcaacccgatcgagctggagaac
accggctacctcacgtatcgtcacatggtgcagggcatgttcgcccatgcaggcgcggtg
cgcatcgaccacatcctcggcctgttccgcctgtggtggatcccctccgggcgcacgccc
aaggacggcgcctatgtgcagtacgattccgagatcatgctcggcatcctggcacttgag
gcgtcgcgcgcccacggcgtggtcgtcggcgaggacctgggcgtcgtgccggaccacgtc
tcgacgtcgctgtccgcgcatcaggtgctgggttgcgccgtcgaatggttcgagcagatg
gacggcaagttccgcgccccaaaggattggcgagagttctcgctcgcctcggtgaacacg
cacgacctgccgcccgcagccggatatctcgcgtacgagcacgtcgaactgcgcgagcgc
ctgggactgatcgaaggatcggtcgaggacttcgagcagaacgcgcgcgccgagcacaag
gccatgatggtcatgctgatcgtcaacggctatctcgaccccgacctgctgaaggacgag
aaagcccacgagcaggagatcgtcgaggcgctgtaccgcggcctgcgcggctccccgtgc
aagctgctcgcggcgtccatcgtggacggcgtgggagagctccgcgcccagaaccagccc
ggcaccaacaacgaatatccgaactggcgcatcccgctggccgacggcaagggcaatgtc
gtgccgctggaggagctgttctccaacacgcgtctgctctcgctcgccaaggtcatgcag
gggcgctga

DBGET integrated database retrieval system