KEGG   Bifidobacterium bifidum S17: BBIF_1771Help
Entry
BBIF_1771         CDS       T01328                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bbi  Bifidobacterium bifidum S17
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:bbi00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2168071..2169111
Genome map
AA seq 346 aa AA seqDB search
MSATAMDNVRSATPGQVRRSPSVPAHWPIRRHAAAAETTPAGPLHSVEVTVPAKTNLTLH
VGPAHEEWGGRHALDTIYCAISVNDMVTATAKTPGSGFSLELSGEHLGDLASSGSDMRRN
HAVLALFAIARAAGREPDVALHVDKHIPVGAGLGGGSADAAATLLAVNTLWGLHWPIERL
RDIAATLGADMPFCLEGGYAHGTGFGERIIPLEDDSSCVQTLRDRGFAGQLLVGAYHAQL
STPNVYSTFDKMGAGDGDDNHLQRAAVALHPRSGEAIEAALAAGASRSFVSGSGPSVIAF
VPDDAVARRVRTAWEQSATVDRIIAAQAPARPVITVLPSLSYRVRQ
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccacagcaatggacaatgtacggtcagcgacaccgggtcaggtgcggcgttcg
ccaagcgtccccgcgcattggcccatccgccgtcatgccgcagccgcggaaacgacaccg
gccgggccgctgcactcggtggaggtcacggttcccgcgaaaaccaatctgacgttgcac
gtagggcccgcccatgaggaatggggcggacggcacgcgctggacacgatatattgcgcc
atcagcgtcaacgacatggtgacggcgaccgccaagacccccggcagcgggttctcgctc
gaactgagcggcgagcatctgggtgatctggcatcgagcggcagcgacatgcgccgcaac
catgcggtgcttgcgttgttcgcgatagccagggccgcggggcgggagccggacgtggcg
ctgcatgtggacaagcacattcccgtcggtgccggattgggcggcggatccgccgacgcg
gcggcgacattgctcgccgtgaacaccctgtggggactgcactggccgattgaacggctg
cgtgacatcgccgccacgctcggcgccgatatgcccttctgcctggagggcggatatgcg
catggcaccggtttcggcgagcggatcatcccgctggaggatgattcatcgtgcgttcag
acgctgcgagaccgtggattcgccggccaattgctggtgggagcgtaccatgcgcaactg
agcacgccgaatgtctactcgaccttcgacaagatgggcgcgggagacggcgacgacaac
catctgcagcgcgccgcggtcgccttgcacccccgcagcggcgaagccatcgaagccgcc
ctggccgccggggcatcccggtcattcgtttccggctccggcccatcggtcatcgcgttc
gtaccggacgatgccgtcgcccgccgagttcgcaccgcatgggagcaatccgccacggtg
gatcgcatcatcgctgcgcaggcgccggcgagaccggtcataaccgtcctgccatccctg
tcttatcgcgtcagacagtga

DBGET integrated database retrieval system