KEGG   Borrelia burgdorferi JD1: BbuJD1_0791Help
Entry
BbuJD1_0791       CDS       T02081                                 

Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
bbj  Borrelia burgdorferi JD1
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbj00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BbuJD1_0791
Enzymes [BR:bbj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BbuJD1_0791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
828944..830047
Genome map
AA seq 367 aa AA seqDB search
MGFCLDFANKEDTKLNNIVSVSHFDFRVKINLILVVGPMGSGKTEYAAKIYKDSLVVRKK
SFKVLGNIIKGNRSRVNVFFIRNFLDKRRFQNYPENVIPYRGGGKDKIDEIGYASNSFDI
ENLIASNPSCGTFIIDEACFYDERLIFVLNKISSNENILFILPTLLYNFRKESFNDTAKL
LVEYSDKIYKLGAYCGHIDCMEESFFSYRYYFYNNKEIPAPYFDPLLIVGGDEEIESAIY
PNYSTRCSMHHYLIGKEYFFSFLKPFALLYSQGDKKFLENEIVALSTDVENSNFVNSLDS
EKACEFRAEILRNILELPFLAERALITLFSEYSILSKDNFKDLVFKFSLNKDYINKIFFS
KEGKEFF
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
ttgggtttttgtttagactttgctaataaagaagatactaaattaaataacattgtctct
gttagtcattttgattttagggtaaaaataaacttaattcttgtagttggacccatggga
agtggaaaaacagaatatgctgcaaaaatttataaagattcgcttgttgtaagaaaaaaa
tctttcaaggtattgggcaatattattaaaggaaatagaagtagggttaatgtatttttt
attagaaattttctcgacaagaggaggtttcaaaattatccagaaaacgtaataccatat
agaggcggtggaaaagataaaattgatgagattggttatgctagcaactcttttgatatt
gaaaatttaatagcctctaatcctagttgtggcacttttattattgatgaggcatgtttt
tatgatgaacgtttaatttttgttttaaataaaatttcatcaaatgagaatattttattt
atattacctacactgctttataattttagaaaagaatctttcaatgatactgccaaactt
ttagtagaatattcagataagatttataagcttggagcttattgtgggcacattgattgc
atggaagaatcttttttttcgtataggtattatttttacaacaataaagaaattccagct
ccttattttgatcctttgcttattgttggtggcgatgaagagattgaatctgctatttac
ccaaattactctacaagatgttcaatgcaccattatcttataggtaaggaatattttttt
tcttttttaaagccatttgctttgctatattcacaaggagataaaaaatttcttgaaaat
gaaattgtagcactaagcacggatgttgaaaattctaattttgtaaattctttagatagt
gaaaaagcgtgtgaatttagagctgaaattttaagaaatattttagaattgcctttttta
gcagaaagagccttaataactcttttctcagaatatagtattttgagtaaggataatttt
aaagatcttgtttttaagttttctttaaataaggattatataaataaaatttttttttcc
aaagagggcaaagagtttttttaa

DBGET integrated database retrieval system