KEGG   Bartonella bacilliformis: BARBAKC583_0026Help
Entry
BARBAKC583_0026   CDS       T00456                                 

Gene name
sucB
Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bbk  Bartonella bacilliformis
Pathway
bbk00020  Citrate cycle (TCA cycle)
bbk00310  Lysine degradation
bbk01100  Metabolic pathways
bbk01110  Biosynthesis of secondary metabolites
bbk01120  Microbial metabolism in diverse environments
bbk01130  Biosynthesis of antibiotics
bbk01200  Carbon metabolism
Module
bbk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bbk_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bbk00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BARBAKC583_0026 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    BARBAKC583_0026 (sucB)
Enzymes [BR:bbk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BARBAKC583_0026 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: ABM45275
UniProt: A1UQW2
Position
29972..31177
Genome map
AA seq 401 aa AA seqDB search
MATEIRVPTLGESVTEATIGKWFKQFGETVAVDEPLVELETDKVTVEVPSPVAGKLSEIV
AKEGDTVEVGALLGMVEAGAVGTISSPSPAVAPSSVVTSAPAPQFSGHSMPPAPSAAKLM
AENNIEKIDISGSGKHGQILKEDVLNALTQKVAAPASVESSSSAMSANSVREERVRMTKL
RQTIARRLKDAQNIAAMLTTFNEVDMSAVMDLRKRYKDVFEKKHGAKLGFMGFFTKAVCH
ALKELPAVNAEIDGTDIVYKNYVNAGIAVGTDKGLVVPVIRDADQKSIAEIEKEIVHLGR
LARDGKLAVTDMQGGTFTITNGGVYGSLMSTPILNAPQSGILGMHAIKERAVVVGGQIVI
RPMMYLALSYDHRIVDGQEAVTFLVRVKESLENPERLVLDL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggctactgaaattcgtgttcctactttgggtgaatcggttactgaggcaactattgga
aaatggtttaagcagtttggtgaaaccgtggctgtagatgagcctttagttgaattagaa
actgacaaagtaacagttgaagttccttcgcctgttgcagggaaattatctgagattgtc
gcaaaggagggtgatacagtagaggtgggagctctattagggatggttgaagctggagct
gttggcaccatttcatcaccttcacctgctgttgctcctagttcggtggtaacatctgca
ccagctccacaattttcaggtcattcaatgcctcctgctccttcggcagcaaaattgatg
gctgaaaataatatagaaaaaatcgatatttcaggttctggaaagcatggacaaattctc
aaagaagatgtgcttaacgccttgacacaaaaagtagcagcaccagcttctgttgaatca
tcttcttcagcaatgtctgctaatagcgtgcgtgaagagcgggttcgtatgaccaagttg
cgtcagacgatagcacgtcgtcttaaagatgcacagaatatagcagcaatgttaaccaca
tttaatgaggttgatatgtctgctgttatggatttacgtaagcgttataaagatgttttt
gagaaaaaacatggtgctaagcttggttttatgggattttttactaaagctgtttgtcat
gcattaaaagaacttcctgctgttaatgctgaaattgatggaacagatattgtttataaa
aattacgttaatgctggaatagcggttggaacagacaagggccttgttgttccagtaatt
cgtgatgcagatcaaaagtcaattgcagaaattgaaaaagagattgttcatttagggcgt
cttgctcgtgatggcaaattggctgttacggatatgcagggtgggacattcaccattacg
aatggtggagtttatggatcgctcatgtcgacacctattttgaatgcaccacaatctggt
attttgggaatgcatgcgattaaagaacgtgcggtggttgttggaggtcagattgtcatc
cgtccaatgatgtatttagccctttcttatgatcaccgtattgtagatggacaagaagct
gtaacattccttgtacgtgttaaggaaagtctagaaaatccggaacgtcttgtccttgat
ttataa

DBGET integrated database retrieval system