KEGG   Bartonella bacilliformis: BARBAKC583_0201Help
Entry
BARBAKC583_0201   CDS       T00456                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bbk  Bartonella bacilliformis
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bbk00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bbk00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
202726..204021
Genome map
AA seq 431 aa AA seqDB search
MDSIKITGGNILNGVIPISGAKNAALPLMIAALLTDETLIVDNVPHLADVECLIRILNNH
GIGYAVEGRQCHTVCSDARTIYFTAKNITTIRAPYELVRKMRASFWVIGPLLARCQEACV
SLPGGCAIGTRPVDFILEGLKALGADIAIENGYVHAKALKGLKGASYHFPKVTVGGTHVL
LMAAVLAEGKTVLHNAACEPEVTNLVQALKAMGADISGEGTDVLTIHGVKKLHGARVCVI
PDRIEAGTYAMAVAMTGGDVLLQDAVPEHLTEVLTVLEKAGLSIEIKAEGIRVFRDPHKK
MKSVDITTAPFPAFPTDLQAQFMALMTLAEGNTHITETIFENRFMHVQELVRLGARITLQ
GKTATVHGTDKLQGAQVMATDLRASVSLVIAALAAEGETTVNRVYHLDRGFERLEEKLAQ
CGACIQRVTTS
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggattcaattaaaattacagggggtaatatccttaatggggttattccaatttctgga
gctaaaaatgctgcgttgccgcttatgattgctgcgttgcttaccgatgaaacactcatt
gttgacaatgtccctcatcttgcagatgttgaatgtcttatccggattttaaacaatcat
ggcatcggttatgctgttgaaggacggcaatgccacactgtgtgtagcgatgcacgaacc
atctattttaccgcaaaaaacatcaccacaatacgcgcgccttatgaacttgtcagaaaa
atgcgggccagcttctgggtgattgggccgcttcttgcccgctgtcaggaggcttgtgtt
tccctaccaggggggtgtgctattggaacacgccctgttgatttcatccttgaagggcta
aaagctttaggtgccgatattgctatcgaaaatggctatgtgcatgcaaaagcgctaaaa
ggtttaaaaggggcttcttaccattttcccaaagtgaccgttgggggaacgcatgttttg
ctgatggctgctgtgttggcagaaggaaaaactgttcttcacaatgctgcgtgtgaaccg
gaagtgaccaaccttgtgcaagcgctgaaagctatgggagctgatatctctggcgaaggc
acggatgttttaaccattcatggtgtcaaaaagcttcatggtgcgcgggtttgtgttatc
cctgatcgtattgaagcgggaacttatgcaatggctgtcgctatgactggaggagatgtc
ttattgcaagacgctgttccggaacatctgacagaagttctcaccgtgcttgaaaaagca
gggctctccattgaaatcaaagcggaaggcattcgcgttttccgcgatccacacaaaaaa
atgaagtctgttgatatcacgacagcgcctttcccagctttcccaactgatctgcaagcg
caatttatggctttgatgacccttgctgaaggaaatacgcatatcacagaaacgattttt
gaaaatcgctttatgcatgtgcaggaattggtgcgtttgggtgcgcgtatcacgttgcag
ggcaaaaccgcaacagtgcacggaaccgataaattgcaaggtgcgcaagtgatggcaaca
gatttgcgggcttctgtctcgctcgttattgcagcgctcgctgctgaaggggaaaccacg
gttaatcgcgtttatcatctggatcgcggctttgaacggttggaagaaaagttagctcag
tgtggggcgtgtattcaacgcgtcacgacttcttaa

DBGET integrated database retrieval system