KEGG   Bartonella bacilliformis: BARBAKC583_0318Help
Entry
BARBAKC583_0318   CDS       T00456                                 

Gene name
proB
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
bbk  Bartonella bacilliformis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bbk01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bbk00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
311166..312305
Genome map
AA seq 379 aa AA seqDB search
MVVQLQKLEQYKRIVIKVGSALLVDPQTGLRIEWLKSLVNDVAVLRQKGVEILLVSSGAI
ALGRTLLHLPKRVLKLEESQACAALGQIELSKAYTDVLAQHGLKTGQILLTLLDTEERRR
YLNARATMNTLLRFGAVPVINENDTVATSEIRYGDNDRLAARVATMMGSDLLVLLSDIDG
LYTCSPHLDPTAEFVPFIASITSDIEKMAGVAASELSRGGMKTKLDAGKIANSAGTAMII
TSGKRMNPLTAIDQGERSSFFAPNEKSVNAWKTWISSHLDPSGILTIDQGAVKALKDGKS
LLAVGIIAVEGVFSRGDTVAIVDEGGVEIARGLVSYDKDDAVNIMGYKSEEIEQILGYEP
HSAVVHRNDMVLRCLTDPI
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggttgttcaattgcaaaaacttgaacaatataagcgcattgtcattaaagttggctct
gcacttttggttgatcctcaaacaggtttgcgcattgaatggcttaaaagtttagtaaat
gatgtggctgtattgcgccaaaagggtgttgaaattttattggtatcttctggtgctatt
gccttagggcgaacattgctacatcttcctaaaagggttttaaaattggaagaaagtcaa
gcatgtgctgctttaggtcaaattgaactttctaaagcgtatactgatgtgcttgctcag
catggattgaaaactggacagattttactaacactattagatacggaagagcgtcgacgt
tatctcaatgcgcgtgctactatgaatacgcttttacgttttggagcagttcctgtgatt
aatgagaatgataccgttgcaacaagcgaaattcggtatggtgataatgatcgtttagct
gcacgtgttgcgacgatgatgggctctgatcttttggttcttttgtcagatatcgatggt
ctttatacatgttctcctcatttagatccaacggctgaatttgttccttttattgcatcc
atcacaagtgatattgaaaaaatggcaggtgttgctgcttcagagctttcacggggtgga
atgaagactaaacttgatgctggaaaaatagctaattctgctggaacagctatgatcatc
acctcaggaaagcgtatgaatcctcttacagcaattgaccaaggggaacgcagcagtttt
tttgctcctaatgaaaaatcagtaaatgcatggaaaacctggatttctagtcatttagat
ccatccggtattttgactattgatcaaggagcggttaaagctcttaaagatggaaaatca
ttattggccgtagggattatagcggttgaaggtgtattttctcgaggagatacggttgca
attgttgatgaaggtggggttgagattgctcgtggtcttgtaagctatgataaagatgac
gctgtgaatattatggggtataaaagcgaggaaatagaacaaattcttgggtatgaaccg
cattctgctgtagtacatcgcaatgatatggttttacgctgcttgactgatcctatttaa

DBGET integrated database retrieval system