KEGG   Bartonella bacilliformis: BARBAKC583_0334Help
Entry
BARBAKC583_0334   CDS       T00456                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bbk  Bartonella bacilliformis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbk00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BARBAKC583_0334 (galU)
   00052 Galactose metabolism
    BARBAKC583_0334 (galU)
   00500 Starch and sucrose metabolism
    BARBAKC583_0334 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    BARBAKC583_0334 (galU)
Enzymes [BR:bbk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BARBAKC583_0334 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
328310..329194
Genome map
AA seq 294 aa AA seqDB search
MQKIRKAVFPVAGLGTRFLPATKTIPKEMLTIVDKPVIQYVVDEALEAGIEHLIFVTGRN
KAVIEDYFDAQVELYATLAERSKKEELQHLQDLQPQPGMTSFTRQQQPLGLGHALWCARE
LVGKEPFALLLPDMLMQAKKGCLSEMIHLYEKTQGGNIVAVQECHAEDVHKYGIVGKGEQ
IANGFEITQMVEKPEKGTAPSNLYINGRYILQPEIFDILSSQERGAGNEIQLTDAMVRLS
DKQAFFGFQLDGKTFDCGSKTGFIEANVAFALARTDLCQQVSSSLKNLLETVKV
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
gtgcaaaagattcgtaaagcagtctttcccgtagcgggtcttggtactcgttttcttcca
gcaacaaaaacaattcctaaagaaatgctgaccattgttgataagcctgttattcaatat
gtagtagatgaagctcttgaggctggtattgagcatcttatttttgtcactgggcgcaat
aaagcagtgatagaagattattttgatgctcaagttgagctttatgcaacacttgctgag
cgtagcaaaaaagaagaactgcagcatttacaagatttacagccgcaaccagggatgaca
tctttcactcgacaacagcaacctttagggcttgggcatgctctttggtgcgcacgtgag
ttggttggcaaggaaccttttgccttattgttaccagacatgttgatgcaagctaaaaaa
ggatgcctttctgaaatgatacatctttatgaaaaaacgcaaggaggaaatatcgttgct
gttcaggagtgtcatgctgaagatgttcataaatatggtattgtcggcaaaggagaacaa
attgcgaatggttttgaaattacacagatggtagagaaaccagaaaaaggaacagctccg
tctaatttatacattaatggacgttatattttgcaaccagaaatatttgatattctctct
agtcaagaacgaggagcaggaaatgaaattcagttgacagatgctatggtgcggctttca
gataagcaggctttttttggttttcagttagatgggaaaacttttgattgtggttctaaa
actggttttattgaagccaatgttgcatttgctttagcacgtacagatttgtgtcaacaa
gtttcttcttcattaaaaaatttattggagacggtaaaagtttag

DBGET integrated database retrieval system