KEGG   Bartonella bacilliformis: BARBAKC583_0387Help
Entry
BARBAKC583_0387   CDS       T00456                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bbk  Bartonella bacilliformis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbk00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BARBAKC583_0387 (ispE)
Enzymes [BR:bbk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     BARBAKC583_0387 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
385681..386595
Genome map
AA seq 304 aa AA seqDB search
MISTVQDSLEGHFHVLTPIKLNLALHIVGQRTDGYHLLESLVYFSLSGDCLSYAPCERDR
FILTGPFAKGLSCNSINLAVRARDFMHKTFPRSAKPSSFQLMKTLPVASGIGGGSGDAAS
ILNILRQKWKLDCSCEELAEMSLALGADVPMCLFALEYQQPLFVKGIGNDVTRLEEACSI
AMVLVNHGQKIATETIFNALEKRNHPPLKINPVALKTVSSLVEVLQETRNDLFIPALKIA
PQLAEVLSTLDESGSLFSRMSGSGATCFGIFKDQQAAQKAAAFIKSMHPNWFVKSIITLG
RSSQ
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgatatcaacagtgcaagattcacttgaagggcattttcatgtattgacacccatcaag
ttgaatttggctttgcatattgtagggcaacgtactgatggttatcatttattagaaagt
ttggtctattttagtctcagcggtgattgtttgagctatgcaccttgtgagagagatcgc
tttattttgacaggcccttttgctaaagggctttcttgtaattccattaatctggctgtg
cgtgcacgtgattttatgcacaagacatttcctagaagtgctaaaccttcttcttttcag
ctcatgaaaacgttgcctgtcgcttcgggtattggtggtggatctggtgatgctgctagc
attttaaacatattgcgtcagaaatggaagttagattgttcttgtgaagaattagcggaa
atgagtttagcgcttggtgctgatgtgccaatgtgtctttttgcgttggaatatcagcag
ccgctttttgttaaaggaattggcaatgacgtaacacggctagaagaggcttgttctatt
gcaatggtactcgttaatcatggtcaaaaaattgcaacagagactatttttaatgctttg
gaaaagcgcaatcatccccctttaaaaattaacccggtggctttaaagacggtctcttca
ttagttgaagttttacaagaaacacgtaatgacctttttattcctgcattgaaaattgct
cctcaattggctgaagttttgtctacacttgatgaaagtgggtctcttttttcccgtatg
tctgggtcgggggcaacctgttttggcatttttaaagatcagcaagcagcacagaaggca
gctgcttttattaaatcgatgcatcccaattggtttgttaaatctatcattactttagga
agatcttcacagtga

DBGET integrated database retrieval system