KEGG   Bartonella bacilliformis: BARBAKC583_0387Help
Entry
BARBAKC583_0387   CDS       T00456                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bbk  Bartonella bacilliformis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:bbk00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
385681..386595
Genome map
AA seq 304 aa AA seqDB search
MISTVQDSLEGHFHVLTPIKLNLALHIVGQRTDGYHLLESLVYFSLSGDCLSYAPCERDR
FILTGPFAKGLSCNSINLAVRARDFMHKTFPRSAKPSSFQLMKTLPVASGIGGGSGDAAS
ILNILRQKWKLDCSCEELAEMSLALGADVPMCLFALEYQQPLFVKGIGNDVTRLEEACSI
AMVLVNHGQKIATETIFNALEKRNHPPLKINPVALKTVSSLVEVLQETRNDLFIPALKIA
PQLAEVLSTLDESGSLFSRMSGSGATCFGIFKDQQAAQKAAAFIKSMHPNWFVKSIITLG
RSSQ
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgatatcaacagtgcaagattcacttgaagggcattttcatgtattgacacccatcaag
ttgaatttggctttgcatattgtagggcaacgtactgatggttatcatttattagaaagt
ttggtctattttagtctcagcggtgattgtttgagctatgcaccttgtgagagagatcgc
tttattttgacaggcccttttgctaaagggctttcttgtaattccattaatctggctgtg
cgtgcacgtgattttatgcacaagacatttcctagaagtgctaaaccttcttcttttcag
ctcatgaaaacgttgcctgtcgcttcgggtattggtggtggatctggtgatgctgctagc
attttaaacatattgcgtcagaaatggaagttagattgttcttgtgaagaattagcggaa
atgagtttagcgcttggtgctgatgtgccaatgtgtctttttgcgttggaatatcagcag
ccgctttttgttaaaggaattggcaatgacgtaacacggctagaagaggcttgttctatt
gcaatggtactcgttaatcatggtcaaaaaattgcaacagagactatttttaatgctttg
gaaaagcgcaatcatccccctttaaaaattaacccggtggctttaaagacggtctcttca
ttagttgaagttttacaagaaacacgtaatgacctttttattcctgcattgaaaattgct
cctcaattggctgaagttttgtctacacttgatgaaagtgggtctcttttttcccgtatg
tctgggtcgggggcaacctgttttggcatttttaaagatcagcaagcagcacagaaggca
gctgcttttattaaatcgatgcatcccaattggtttgttaaatctatcattactttagga
agatcttcacagtga

DBGET integrated database retrieval system