KEGG   Bartonella bacilliformis: BARBAKC583_0528Help
Entry
BARBAKC583_0528   CDS       T00456                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bbk  Bartonella bacilliformis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bbk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BARBAKC583_0528 (tpiA)
   01230 Biosynthesis of amino acids
    BARBAKC583_0528 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BARBAKC583_0528 (tpiA)
   00051 Fructose and mannose metabolism
    BARBAKC583_0528 (tpiA)
   00562 Inositol phosphate metabolism
    BARBAKC583_0528 (tpiA)
Enzymes [BR:bbk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BARBAKC583_0528 (tpiA)
Exosome [BR:bbk04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BARBAKC583_0528 (tpiA)
  Exosomal proteins of bladder cancer cells
   BARBAKC583_0528 (tpiA)
  Exosomal proteins of melanoma cells
   BARBAKC583_0528 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
536964..537728
Genome map
AA seq 254 aa AA seqDB search
MTSSIRPLLAGNWKMNGTSESLRELRAIASGIDSDRDRCFEALVCVPATLLSRASDILSD
ENIFLGGQDCHFNDSGPHTGDISACMLKEAGASHVILGHSERRTDYRESDAIVCAKVKAA
WRAGLVALICIGETLEERENNTVLDVLAQQLKGSVPAGAMDHNTVIAYEPRWAIGTGKTP
TSEDIAQVHGFIRKEVSHRFGDEGHKIRLLYGGSVKPSNASELLETSHVNGALIGGASLK
ATDFLTICNIYRKL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgacttctagtattcggcctttgcttgccggaaattggaaaatgaatgggactagcgaa
tctcttagagaattacgggctattgcttctggtattgattctgaccgagatcgttgcttt
gaagcgcttgtttgtgttccagcaacacttttatcacgtgcttctgatatattaagtgat
gaaaatatttttttaggggggcaagattgccattttaatgatagtggtcctcatactgga
gatatttcggcatgtatgcttaaagaagcaggagcaagtcatgtcattcttggacattca
gagcgccgtacagattatcgtgaaagtgatgcaattgtctgtgctaaagtgaaagctgcg
tggcgggcaggtcttgtggctcttatttgtattggtgaaacattagaagagcgtgaaaat
aacacagtgttggatgtgcttgcacagcaacttaaaggatccgtgccagcgggagcaatg
gatcacaataccgttattgcttatgaaccgagatgggctataggtacaggaaagacacct
acttcagaagatattgcacaagtgcatggtttcattcgtaaagaggtcagccatcgtttt
ggtgatgaggggcacaaaatacgcttgctttatggtggatcagtcaaaccatccaatgca
tctgagcttttggagacgagtcacgttaatggtgctctgattggtggagcaagcttaaaa
gcaactgattttttaactatttgcaacatttatcgtaaattataa

DBGET integrated database retrieval system