KEGG   Bartonella bacilliformis: BARBAKC583_0536Help
Entry
BARBAKC583_0536   CDS       T00456                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bbk  Bartonella bacilliformis
Pathway
bbk00010  Glycolysis / Gluconeogenesis
bbk00020  Citrate cycle (TCA cycle)
bbk00620  Pyruvate metabolism
bbk01100  Metabolic pathways
bbk01110  Biosynthesis of secondary metabolites
bbk01120  Microbial metabolism in diverse environments
bbk01130  Biosynthesis of antibiotics
bbk01200  Carbon metabolism
Module
bbk_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bbk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BARBAKC583_0536 (pdhC)
   00020 Citrate cycle (TCA cycle)
    BARBAKC583_0536 (pdhC)
   00620 Pyruvate metabolism
    BARBAKC583_0536 (pdhC)
Enzymes [BR:bbk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BARBAKC583_0536 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 RnfC_N Peptidase_M23 ATP-synt_ab_Xtn GCV_H
Motif
Other DBs
NCBI-ProteinID: ABM44495
UniProt: A1US98
Position
545508..546833
Genome map
AA seq 441 aa AA seqDB search
MPIKITMPALSPTMEEGNLSKWNIKEGDKVSSGDVIAEIETDKATMEVEAIDEGTVAKIV
VPAGTQGVKVNALIVILAEEGEDLAEAVKAAEEDVALSGKKSKVTKQVEAKEELVADASL
AQQFIQRDGDNTRLFASPLARRLAAESGFDLSVISGTGPHGRIIKRDVEKALSGGALRDS
RSSSVNRPIVTGASDEQVMKLFKESEYTFASHNSMRKTIAKRLVESKSTIPHFYVTVDCE
LDALLKLRAELNAIAPMVTTQENMNPAYKLSVNDMVIKAVALSLRALPDANVSWLEGGML
YHKHCDVGVAVSIPNGLITPIIRHAEEKSLPVISNEMKDFATRARANKLKPEEYQGGTTA
ISNMGMYGVKDFSAIINPPHATIFAIGAGEQRAVVKNGALAIATVMSVTLSVDHRAVDGA
LAAELVQTFKKLIENPLSILV
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgcccattaagatcacaatgcctgcgctttctcctacaatggaagaaggaaatttatca
aaatggaatatcaaagagggtgataaagtttcttctggtgatgttatcgctgagattgaa
acagataaagcgacaatggaagtagaagccattgatgaaggaacagtcgctaaaatcgtt
gttcctgctggaacacaaggggttaaagtcaatgctttgattgttatattagcagaggaa
ggtgaagatttagctgaggcagtaaaggctgcagaagaagatgtcgctctttcagggaaa
aaatcaaaagttacaaaacaggtagaagcaaaagaagaattggttgctgatgcatcacta
gctcagcaatttatacaaagagatggagacaatacacgtctttttgcctctcccttggcg
cggcgattagcagctgaatcaggttttgatttatcggttatttctggaactggtcctcat
gggcggattataaagcgtgatgtagagaaagctctgagtggtggtgctttaagagattct
cgttcatcatcggtcaatcggccaatagttacaggtgcttctgatgaacaagtaatgaag
ttatttaaagagagtgaatatacatttgcatctcataacagtatgcgcaaaacaatcgct
aaacgtttagttgaatcaaaaagtacgataccgcatttttacgtaactgtagactgtgaa
cttgatgcgttattaaaactgcgtgcagagcttaatgccattgctccaatggttacaacg
caagaaaatatgaatcctgcttataagctgtcagtcaatgatatggttattaaagctgtt
gctctttctttaagggcgttacctgatgctaatgtatcatggcttgaaggtgggatgctt
tatcataaacactgtgatgttggtgttgctgtttctattcccaatgggttaattacacca
attattcgccatgcagaagaaaagtcgttgccagttatttctaatgagatgaaagatttt
gcaacgcgtgcacgtgcaaataagttaaaaccagaggaatatcaagggggaacaacagcc
atatcaaatatggggatgtatggcgtaaaagatttttctgctattattaatcctccgcat
gcaacgattttcgcgattggtgcaggtgagcaacgtgcagttgttaagaatggtgcatta
gcgatagcaacagtgatgtcggtcacactttcagttgatcatcgtgctgttgatggtgca
ttagcagcagagcttgttcagacttttaagaagctgattgaaaatcctctatcaatatta
gtttag

DBGET integrated database retrieval system