KEGG   Bartonella bacilliformis: BARBAKC583_0618Help
Entry
BARBAKC583_0618   CDS       T00456                                 

Definition
zinc-binding dehydrogenase family oxidoreductase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bbk  Bartonella bacilliformis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bbk00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BARBAKC583_0618
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BARBAKC583_0618
  Lipid metabolism
   00071 Fatty acid degradation
    BARBAKC583_0618
  Amino acid metabolism
   00350 Tyrosine metabolism
    BARBAKC583_0618
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BARBAKC583_0618
   00626 Naphthalene degradation
    BARBAKC583_0618
Enzymes [BR:bbk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BARBAKC583_0618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(633193..634221)
Genome map
AA seq 342 aa AA seqDB search
MRALQLFNERQVGITHIALPPPPSPGEVTVRIKAVALNHIDVWGWRGMAFAKRKMPLTIG
AEASGEIIQLGNGVDNLQLGQLVSIYGAHTCGLCQACHKGHDNLCSHVKGVHGFHLDGFA
CELINLPARLLVPAPSECDEIQAAVAPVTFGTVEHMLFDNAKLQIGETILIHAGGSGIGS
AAIQIAKSMKCTIITTVGSDNKIAKAQSLGANYVINYRKDRFEGVVRKLTQKKGVDVVFE
HVGADTWAGSMLCMKQGARLVTCGSTSGVSAPMNLMQLFQQQLKIFGSFGCRMENMANAM
QKMAQGIIHPIIDTIVHFDDIDVALKRMEKRDVFGKIILKID
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcactgcaattatttaatgagcgccaagttggaataacccatatcgccttacca
ccccctcctagccctggtgaagtaacagtgcgtataaaagctgttgctcttaaccatatc
gatgtgtggggatggcgtggtatggcctttgctaaaaggaaaatgcctctcactataggt
gcagaagcttcaggtgaaattattcagctgggaaatggtgttgataatttgcaacttgga
cagctcgtctcaatttatggtgctcacacctgtggtctgtgtcaagcttgtcataaaggg
catgacaatctctgcagtcatgtaaaaggtgtacatggttttcacctagatggatttgcc
tgtgaactcattaatcttccagcacgtctgctcgtgccagcaccttcagaatgtgatgaa
atacaagcagctgttgctccagttacctttggtaccgtagaacatatgctttttgacaat
gcaaaattacaaattggagaaacaattcttatacatgctggtggttctggtattggctca
gctgctattcagatcgcaaaatctatgaaatgtacaattattacaactgtgggctccgat
aacaagattgcaaaagcacaatcccttggagcaaattatgttattaattaccgtaaagac
cgctttgaaggtgtagtccgtaaattaactcaaaaaaaaggtgttgacgttgtttttgaa
catgtcggtgctgatacatgggcaggttctatgttgtgcatgaaacaaggagcacgtttg
gtgacttgtggttctacttctggtgtttccgctcctatgaatttaatgcaactgtttcag
caacaacttaaaatatttggttcatttggctgtcgtatggaaaatatggcaaatgctatg
caaaaaatggcacaaggaattatacatcctattattgatacaattgttcattttgatgac
attgatgttgctttaaaaagaatggaaaagcgtgatgtttttggtaaaattattctcaaa
atcgattaa

DBGET integrated database retrieval system