KEGG   Bartonella bacilliformis: BARBAKC583_0839Help
Entry
BARBAKC583_0839   CDS       T00456                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bbk  Bartonella bacilliformis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bbk00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bbk00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
857353..858318
Genome map
AA seq 321 aa AA seqDB search
MTQNTPFPIFPHRHLLGIKGLTLQDLTTLLDRADANVTLYQKNDKKKSILHGRTQINLFF
ESSTRTQSSFELAGKRLGADVMNMIISNSSVKKGETLIDTATTLNAMNPDILVIRHNCAG
AASLLAQKIDCCVINAGDGAHEHPTQALLDALTIRRTKGRIEGLTVAICGDILHSRVARS
NIISLNTLGARVRVVAPSTLLPTGIEDMGVEVFHTMQEGLKGADVVMMLRLQLERMTGAF
IPSIREYFYHFGLHKENLIYAKNDCIIMHPGPINRGVEIASDIADGTRSMIHTQVEMGIA
VRMAIMEALLDPRHDYNGEKK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaaatactccatttccaatttttccccatcgacatctcttgggtattaagggt
ttaactttacaagaccttactacattacttgatcgtgcagatgcgaacgttaccctttac
caaaaaaatgataaaaagaaatctatattgcatgggcgtactcaaattaatctcttcttt
gaatcttctacacgaacacaatcctcatttgaactagccggtaagcggttaggagcagat
gtgatgaacatgatcatcagcaattcatctgtaaaaaaaggggaaacattaattgataca
gcaacaacccttaacgcaatgaatcctgatatactcgttattcgccataattgcgctgga
gccgcctcacttttagctcaaaagattgactgttgtgtaattaatgcaggtgatggagca
catgaacatccaacacaagctttattagatgctcttactattagaagaacaaaaggtcgt
attgaaggattaactgttgcaatttgtggcgacatcttgcattcacgtgttgcacgttcc
aatatcatcagtcttaatactttaggagcacgtgtccgtgttgttgcaccctcaacattg
ttgcctaccggaattgaagatatgggcgttgaggtttttcatacgatgcaagaaggtctt
aaaggtgctgatgttgttatgatgttacgtttacagcttgagcgtatgacaggtgctttt
attccttctatccgtgaatatttttatcatttcggcttacataaagaaaatctaatctat
gctaaaaatgattgtattatcatgcatcctggcccaataaatcgtggtgtagaaatcgct
tctgatatagctgatggaacacgcagtatgatccatacacaagtagaaatgggaatagct
gtacgcatggctatcatggaagcgttgctggatccgcgccatgattacaatggagaaaag
aaatga

DBGET integrated database retrieval system