KEGG   Bartonella bacilliformis: BARBAKC583_0960Help
Entry
BARBAKC583_0960   CDS       T00456                                 

Definition
isochorismatase family protein (EC:3.-.-.-)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bbk  Bartonella bacilliformis
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BARBAKC583_0960
Enzymes [BR:bbk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     BARBAKC583_0960
    3.5.1.-  
     BARBAKC583_0960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
992741..993349
Genome map
AA seq 202 aa AA seqDB search
MEKKALIVVDVQNDFLPGGALAVLQGNTILPTINDLITRFDHVILTQDWHPKGHLSFASS
HPDKSPYDMINLDYGPQILWPDHCVQGTKGADFHQSLNIDKAQLIIRKGHNRKIDSYSAF
FENDQKTPTGLQNYLKEHSFTKLIMCGLATDFCVAFSALHAVQCGFQVSVVLNACAGIDV
NGSLNIMLKTMHEAGVELLMIY
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaaagctttaatcgttgtggatgttcaaaatgatttccttccaggtggagca
cttgcagtactacaaggcaatactattctaccaactatcaacgatctcataacccgtttt
gaccatgtcattttaacccaagactggcatccaaaagggcatctcagctttgcttcttcc
caccctgataaatccccttatgatatgattaatcttgattatggtcctcaaatactctgg
cctgaccattgcgtacaaggaacaaagggagcggattttcatcaatctctcaacattgat
aaagcacagcttatcatccgcaaaggccataaccggaaaattgacagctattctgctttt
tttgagaatgatcaaaaaacgccaacaggcttacaaaattacctcaaagaacatagcttt
acaaaattgattatgtgcggtttagcaactgacttctgtgttgcattttctgcacttcac
gctgtacaatgtggttttcaagtcagtgtcgtgttaaatgcttgtgctggtattgatgtc
aatgggtcacttaatatcatgcttaaaactatgcatgaagccggtgtagaacttttaatg
atttactaa

DBGET integrated database retrieval system