KEGG   Bartonella bacilliformis: BARBAKC583_1057Help
Entry
BARBAKC583_1057   CDS       T00456                                 

Definition
lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
bbk  Bartonella bacilliformis
Brite
Enzymes [BR:bbk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     BARBAKC583_1057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1092027..1092689)
Genome map
AA seq 220 aa AA seqDB search
MRKISKEGLALIKRWEGVRLCAYQDAIGVWTIGYGHTAQAGQPIVQEGMKITESEAEIVL
RQDLKQFEKTVEQAVIISLSDEQFAALVSFCYNVGGEAFCNSTLLKKLNKGDYEAVPSEL
QKWIRAGGKRLQGLANRRAAEAGLWVKGAYVCSNYQKVETKGPSHSFKAEVLAPIIGSLS
GLTGIFTGQGPVQWALASIMVFSACIGLVLVAKRFQEKRL
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaaatatccaaagaaggacttgcactcattaagcgatgggagggggtacgtttg
tgcgcctatcaagatgccattggagtgtggacaataggctatggccatacagcacaagca
ggacaacccattgtacaggaaggcatgaagatcactgaaagtgaagcagagatcgtttta
cgacaagacttaaaacaatttgaaaaaactgttgaacaggctgtcattatttctttaagc
gatgagcaattcgctgctcttgtatcattttgttataatgtgggaggagaagctttttgc
aactcgacgcttttgaaaaagctgaacaaaggtgattatgaagccgtaccctctgaattg
caaaaatggatccgggcagggggaaagcgtttgcaggggcttgccaatcgtcgggcagca
gaagctggcctatgggtcaaaggggcttatgtgtgttccaattatcaaaaagtagaaacc
aaagggcccagtcattcttttaaagcagaagttcttgctcccatcattggttctttatca
ggtttaacagggatttttacagggcagggtcctgttcaatgggctttagcttccattatg
gttttttctgcctgtataggacttgtcttggttgccaaacgttttcaggaaaaacgctta
tga

DBGET integrated database retrieval system