KEGG   Bartonella bacilliformis: BARBAKC583_1235Help
Entry
BARBAKC583_1235   CDS       T00456                                 

Definition
(GenBank) cytochrome c family protein
  KO
K08738  cytochrome c
Organism
bbk  Bartonella bacilliformis
Pathway
bbk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bbk00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BARBAKC583_1235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 NhaB PSI_8
Motif
Other DBs
NCBI-ProteinID: ABM44819
UniProt: A1UU31
Position
complement(1279398..1279955)
Genome map
AA seq 185 aa AA seqDB search
MNRLIFACCICVCLLLPIVLVGFFFIYHVVDSDSEQVQKSHNIKDNKTIQETQHMSHPPL
LLSDRLQQGNIENGRKLFRQCAICHASERDGANRIGPPLWGVVDRPFAVMKGFTYSKALR
ENSDKKWDFVTLDRYLQSPRKEIPGTTMSFRGVKNDQDRADLLLYLRSLSDHPVPLLGHE
NGEQN
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgattgatattcgcttgttgcatttgtgtttgtttgttactgccaattgttttg
gtagggtttttctttatttaccatgtcgttgatagtgattctgaacaggttcaaaagtcc
cataacattaaggataataaaacgattcaagaaacacaacatatgtctcatcctcctcta
ttattgagtgatcgccttcaacaaggaaatattgaaaatgggcgtaagctttttcgtcaa
tgcgccatatgccatgcatctgaacgtgatggagccaatcgtattggtccaccactttgg
ggggtagtagatcgacctttcgcagttatgaaaggtttcacatattcaaaggcattacgg
gaaaattctgataagaaatgggattttgttactctggatcgttatcttcaatcgcctcgt
aaagaaattccaggaacaacgatgtcttttcgtggggtcaaaaatgatcaagatcgtgct
gaccttttgctttatttgcgcagtctatctgatcatcctgttcctttattaggtcatgaa
aatggtgaacagaattag

DBGET integrated database retrieval system