KEGG   Bartonella bacilliformis: BARBAKC583_1235Help
Entry
BARBAKC583_1235   CDS       T00456                                 

Definition
cytochrome c family protein
Orthology
K08738  
cytochrome c
Organism
bbk  Bartonella bacilliformis
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:bbk00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BARBAKC583_1235
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BARBAKC583_1235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1279398..1279955)
Genome map
AA seq 185 aa AA seqDB search
MNRLIFACCICVCLLLPIVLVGFFFIYHVVDSDSEQVQKSHNIKDNKTIQETQHMSHPPL
LLSDRLQQGNIENGRKLFRQCAICHASERDGANRIGPPLWGVVDRPFAVMKGFTYSKALR
ENSDKKWDFVTLDRYLQSPRKEIPGTTMSFRGVKNDQDRADLLLYLRSLSDHPVPLLGHE
NGEQN
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgattgatattcgcttgttgcatttgtgtttgtttgttactgccaattgttttg
gtagggtttttctttatttaccatgtcgttgatagtgattctgaacaggttcaaaagtcc
cataacattaaggataataaaacgattcaagaaacacaacatatgtctcatcctcctcta
ttattgagtgatcgccttcaacaaggaaatattgaaaatgggcgtaagctttttcgtcaa
tgcgccatatgccatgcatctgaacgtgatggagccaatcgtattggtccaccactttgg
ggggtagtagatcgacctttcgcagttatgaaaggtttcacatattcaaaggcattacgg
gaaaattctgataagaaatgggattttgttactctggatcgttatcttcaatcgcctcgt
aaagaaattccaggaacaacgatgtcttttcgtggggtcaaaaatgatcaagatcgtgct
gaccttttgctttatttgcgcagtctatctgatcatcctgttcctttattaggtcatgaa
aatggtgaacagaattag

DBGET integrated database retrieval system