KEGG   Bartonella bacilliformis: BARBAKC583_1338Help
Entry
BARBAKC583_1338   CDS       T00456                                 

Gene name
dapE
Definition
(GenBank) acetylornithine deacetylase/succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bbk  Bartonella bacilliformis
Pathway
bbk00300  Lysine biosynthesis
bbk01100  Metabolic pathways
bbk01120  Microbial metabolism in diverse environments
bbk01230  Biosynthesis of amino acids
Module
bbk_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:bbk00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    BARBAKC583_1338 (dapE)
Enzymes [BR:bbk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BARBAKC583_1338 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: ABM45162
UniProt: A1UUD2
Position
complement(1392461..1393633)
Genome map
AA seq 390 aa AA seqDB search
MPVLTDPVQLLQALIRCPSITPNEAGALSILEQFLRKMGFSVERPIFSDKNTADVENLYA
KMGNKGPHLMFAGHSDVVPPGELDNWMYPPFEGIINQGKIYGRGAVDMKGAIACFIAALA
RVLEKQPIKGAVSLLITGDEEGPAINGTVKLLKWAAQKGEKWNAAIVGEPTSVKRVGDMI
KIGRRGSISGIITVKGRQGHVAFPERAANPLPLAHKLIQALTDTALDQGTKNFQASNLEL
TTIDTGNSATNIIPAQTVIRFNIRYNDLWTKEALIAEIEKRLALVHSENNSNQYPYYQLE
WIQNLGSVFLIKNDHLIEILSNAIEIVTGKRPECSTSGGTSDARFIKDYCPVVEFGLPGN
TMHMVDECVTLDAMESLTVIYERFIIDFFA
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtccttacagatcctgtccagttgttacaggcgcttattcgttgtccctctatt
acgcctaatgaagctggcgctttatcaattttggaacagtttttaagaaaaatgggattt
agtgttgagcgtcccattttttcagataaaaatacagcagatgttgaaaatttatatgcg
aagatggggaataaggggccgcatcttatgtttgctggccatagtgatgttgtgccacct
ggtgaattagataattggatgtatcctccttttgaggggataattaatcagggtaaaata
tatgggcgaggtgctgttgatatgaagggcgcaatagcttgttttatcgcagcactggcc
cgagttcttgaaaaacaacctataaaaggggctgtgagtcttttgattacaggcgatgaa
gaaggtcccgctattaatggtacagtaaaacttctaaaatgggcagcacaaaaaggcgaa
aaatggaatgcagccattgtcggtgaaccaacaagtgtaaaacgtgttggtgatatgatt
aagattggtcgtcggggatcaatttctggcatcattacagttaaaggtcggcagggacat
gttgcgtttcctgagcgcgcggctaacccattgcctttagcacataaactgattcaggcg
ttgacagatactgctttggaccaaggaacaaagaattttcaagcaagtaatctggaattg
acaactattgatacaggaaattctgctaccaatattattccagcgcaaacagtaattcgt
tttaatattcgctacaatgatctttggacaaaggaagcgctgattgccgaaattgaaaag
cgtcttgctttggtgcattcggaaaataatagcaatcaatacccctattatcagcttgaa
tggatacaaaatttaggcagtgttttcttgatcaaaaatgatcacttaattgaaatattg
tcgaatgctattgaaatagtgacaggaaaaagaccagaatgttcaacttctggtggtact
tccgatgcgcggtttattaaagattactgtccagtcgttgaatttggtttaccagggaac
acgatgcatatggtagacgaatgtgtcactcttgatgctatggaaagcctcacggttatt
tatgaacgttttatcattgatttttttgcgtaa

DBGET integrated database retrieval system