KEGG   Bartonella bacilliformis: BARBAKC583_1338Help
Entry
BARBAKC583_1338   CDS       T00456                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.16 3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bbk  Bartonella bacilliformis
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bbk01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bbk00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1392461..1393633)
Genome map
AA seq 390 aa AA seqDB search
MPVLTDPVQLLQALIRCPSITPNEAGALSILEQFLRKMGFSVERPIFSDKNTADVENLYA
KMGNKGPHLMFAGHSDVVPPGELDNWMYPPFEGIINQGKIYGRGAVDMKGAIACFIAALA
RVLEKQPIKGAVSLLITGDEEGPAINGTVKLLKWAAQKGEKWNAAIVGEPTSVKRVGDMI
KIGRRGSISGIITVKGRQGHVAFPERAANPLPLAHKLIQALTDTALDQGTKNFQASNLEL
TTIDTGNSATNIIPAQTVIRFNIRYNDLWTKEALIAEIEKRLALVHSENNSNQYPYYQLE
WIQNLGSVFLIKNDHLIEILSNAIEIVTGKRPECSTSGGTSDARFIKDYCPVVEFGLPGN
TMHMVDECVTLDAMESLTVIYERFIIDFFA
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtccttacagatcctgtccagttgttacaggcgcttattcgttgtccctctatt
acgcctaatgaagctggcgctttatcaattttggaacagtttttaagaaaaatgggattt
agtgttgagcgtcccattttttcagataaaaatacagcagatgttgaaaatttatatgcg
aagatggggaataaggggccgcatcttatgtttgctggccatagtgatgttgtgccacct
ggtgaattagataattggatgtatcctccttttgaggggataattaatcagggtaaaata
tatgggcgaggtgctgttgatatgaagggcgcaatagcttgttttatcgcagcactggcc
cgagttcttgaaaaacaacctataaaaggggctgtgagtcttttgattacaggcgatgaa
gaaggtcccgctattaatggtacagtaaaacttctaaaatgggcagcacaaaaaggcgaa
aaatggaatgcagccattgtcggtgaaccaacaagtgtaaaacgtgttggtgatatgatt
aagattggtcgtcggggatcaatttctggcatcattacagttaaaggtcggcagggacat
gttgcgtttcctgagcgcgcggctaacccattgcctttagcacataaactgattcaggcg
ttgacagatactgctttggaccaaggaacaaagaattttcaagcaagtaatctggaattg
acaactattgatacaggaaattctgctaccaatattattccagcgcaaacagtaattcgt
tttaatattcgctacaatgatctttggacaaaggaagcgctgattgccgaaattgaaaag
cgtcttgctttggtgcattcggaaaataatagcaatcaatacccctattatcagcttgaa
tggatacaaaatttaggcagtgttttcttgatcaaaaatgatcacttaattgaaatattg
tcgaatgctattgaaatagtgacaggaaaaagaccagaatgttcaacttctggtggtact
tccgatgcgcggtttattaaagattactgtccagtcgttgaatttggtttaccagggaac
acgatgcatatggtagacgaatgtgtcactcttgatgctatggaaagcctcacggttatt
tatgaacgttttatcattgatttttttgcgtaa

DBGET integrated database retrieval system