KEGG   Blattabacterium Bge (Blattella germanica): BLBBGE_009Help
Entry
BLBBGE_009        CDS       T00995                                 

Definition
dihydrolipoyllysine-residue acyltransferase (EC:2.3.1.-)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bbl  Blattabacterium Bge (Blattella germanica)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bbl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BLBBGE_009
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BLBBGE_009
  Amino acid metabolism
   00310 Lysine degradation
    BLBBGE_009
Enzymes [BR:bbl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BLBBGE_009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9211..10419
Genome map
AA seq 402 aa AA seqDB search
MAEYNLTLPAMGESIAEATIIRWLKKEGDSIKKEDLLVEIATDKVDSEISSPVNGILKKK
LFYPNEVAKVGSPIAILETEEELKKLPIKDEIIKENKKRFYSPLVRTIAHKEGVSFYELE
TIEGTGAKGRVTKKDILKYIQKNKIIPPKYSDMFLSYHTKNNNMMIENEEIVEMDRMRRI
TAEHMMNSKNISAHVTSFVEADVTNIVKWREKMKDSFQKNTGEKLTLMSVFVECVVKAIK
DLPMINISVNGTNIIKKRNIHIGLATALPNGNLIVPVIKHADSYSLGGLIKIINDLIKRA
KSNQLKPEETQGGTYTISNIGSFGNLFGTPIIHQPQVAIMAIGLIQKKLSIIETPEGDLI
GIRHKIYLSHSYDHRVIDGVLGGGFAKKVALYLEKFNCYTKI
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggccgagtataatttgacccttccagccatgggtgaaagtatagctgaggctactatc
attcgttggttaaaaaaagagggagattctataaaaaaagaagaccttttggtagaaata
gctacagataaagtagattctgaaatttcttctccagtcaatgggatattaaaaaagaaa
ttattttatcccaatgaagtggctaaggtgggaagtccaatagcaattttagaaacagaa
gaagaattaaaaaaattgcctataaaagatgaaataataaaagaaaataaaaaacgtttt
tattctcctcttgtacgtactattgctcataaagaaggtgttagtttttacgaattggaa
acaatagaggggactggagcaaaaggccgtgtcactaaaaaagacatattaaaatatatt
caaaaaaataaaatcattccgcctaaatacagtgatatgtttctatcatatcatacaaaa
aataataatatgatgatagaaaatgaagaaattgtagaaatggatagaatgcgtagaatc
actgcagaacatatgatgaacagcaaaaatatatctgcacatgttacttcttttgtagaa
gcagatgtaacaaatattgtgaaatggagagaaaaaatgaaagattcttttcaaaaaaat
acaggagaaaaactaactttaatgtctgtttttgtggaatgtgtggttaaagccattaag
gatcttcctatgatcaatatttccgtaaatggtacgaatataataaagaaaagaaatatt
catataggattagcgacagctttacctaatggtaatttaattgttcctgttataaaacac
gcagattcttatagtttaggaggattaataaaaatcattaatgacttaataaaaagagct
aaatctaatcaattaaaaccagaagaaactcaagggggaacttatacaattagcaatatt
ggtagttttggaaatctttttggaactccaattatacatcaaccacaggttgctattatg
gctatagggttgatccaaaaaaaattatctattatagaaacgccagaaggtgatttaata
ggaattagacacaaaatttatttgtctcattcttatgatcatcgtgtaatagatggagtt
ttgggaggaggatttgctaaaaaggttgctttatatttggaaaaatttaattgttatacg
aaaatataa

DBGET integrated database retrieval system