KEGG   Blattabacterium sp. (Blattella germanica): BLBBGE_009Help
Entry
BLBBGE_009        CDS       T00995                                 

Definition
dihydrolipoyllysine-residue acyltransferase (EC:2.3.1.-)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bbl  Blattabacterium sp. (Blattella germanica)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bbl01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bbl00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:bbl00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9211..10419
Genome map
AA seq 402 aa AA seqDB search
MAEYNLTLPAMGESIAEATIIRWLKKEGDSIKKEDLLVEIATDKVDSEISSPVNGILKKK
LFYPNEVAKVGSPIAILETEEELKKLPIKDEIIKENKKRFYSPLVRTIAHKEGVSFYELE
TIEGTGAKGRVTKKDILKYIQKNKIIPPKYSDMFLSYHTKNNNMMIENEEIVEMDRMRRI
TAEHMMNSKNISAHVTSFVEADVTNIVKWREKMKDSFQKNTGEKLTLMSVFVECVVKAIK
DLPMINISVNGTNIIKKRNIHIGLATALPNGNLIVPVIKHADSYSLGGLIKIINDLIKRA
KSNQLKPEETQGGTYTISNIGSFGNLFGTPIIHQPQVAIMAIGLIQKKLSIIETPEGDLI
GIRHKIYLSHSYDHRVIDGVLGGGFAKKVALYLEKFNCYTKI
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggccgagtataatttgacccttccagccatgggtgaaagtatagctgaggctactatc
attcgttggttaaaaaaagagggagattctataaaaaaagaagaccttttggtagaaata
gctacagataaagtagattctgaaatttcttctccagtcaatgggatattaaaaaagaaa
ttattttatcccaatgaagtggctaaggtgggaagtccaatagcaattttagaaacagaa
gaagaattaaaaaaattgcctataaaagatgaaataataaaagaaaataaaaaacgtttt
tattctcctcttgtacgtactattgctcataaagaaggtgttagtttttacgaattggaa
acaatagaggggactggagcaaaaggccgtgtcactaaaaaagacatattaaaatatatt
caaaaaaataaaatcattccgcctaaatacagtgatatgtttctatcatatcatacaaaa
aataataatatgatgatagaaaatgaagaaattgtagaaatggatagaatgcgtagaatc
actgcagaacatatgatgaacagcaaaaatatatctgcacatgttacttcttttgtagaa
gcagatgtaacaaatattgtgaaatggagagaaaaaatgaaagattcttttcaaaaaaat
acaggagaaaaactaactttaatgtctgtttttgtggaatgtgtggttaaagccattaag
gatcttcctatgatcaatatttccgtaaatggtacgaatataataaagaaaagaaatatt
catataggattagcgacagctttacctaatggtaatttaattgttcctgttataaaacac
gcagattcttatagtttaggaggattaataaaaatcattaatgacttaataaaaagagct
aaatctaatcaattaaaaccagaagaaactcaagggggaacttatacaattagcaatatt
ggtagttttggaaatctttttggaactccaattatacatcaaccacaggttgctattatg
gctatagggttgatccaaaaaaaattatctattatagaaacgccagaaggtgatttaata
ggaattagacacaaaatttatttgtctcattcttatgatcatcgtgtaatagatggagtt
ttgggaggaggatttgctaaaaaggttgctttatatttggaaaaatttaattgttatacg
aaaatataa

DBGET integrated database retrieval system