KEGG   Blattabacterium Bge (Blattella germanica): BLBBGE_059Help
Entry
BLBBGE_059        CDS       T00995                                 

Gene name
rocF
Definition
arginase (EC:3.5.3.1)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bbl  Blattabacterium Bge (Blattella germanica)
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbl00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BLBBGE_059 (rocF)
Enzymes [BR:bbl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     BLBBGE_059 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(57093..57965)
Genome map
AA seq 290 aa AA seqDB search
MKKHYKKKTFAGISEKYATLETSKIVLIPVPYDSTQTWKKGSRKGPKAFLSAAKHMELYD
IETDSEVYKKGIFLVSPIVNHSISSKKMVQKVYNTTKKYLFKEKFVTLIGGDHSISIGSI
RAFGEKYPNLSILHMDAHIDLRPVYKGNPYNHACSMYEASRKYPLIQIGIRSMDILEKKF
LQKGNVFYMHEIYKNDLWMKKAIQKLSKNVFISIDIDVFDPSITPSTGTPEPGGLDWYTT
LRFFKKVFQKKKIIGFDIVELLPDEKESSTDFLAVKLYYKLLSYKYELTI
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaacattataaaaaaaaaacttttgcaggaatatctgaaaaatatgctacactt
gaaacatctaaaattgtactgattcctgttccatatgattctactcaaacatggaaaaaa
ggttctcgaaaaggacctaaagcatttttatctgcagcaaaacatatggagttgtatgat
attgaaaccgattcagaagtatataaaaaaggaatttttcttgtatctcccattgtaaat
cattcaatatcctctaaaaaaatggttcaaaaagtatacaatactacaaaaaagtacctt
ttcaaagaaaaatttgtaacccttataggaggagatcattctatatcaataggaagcatt
agagcttttggagaaaaatatccaaatttaagtattcttcacatggatgcacatatagat
ttacgtcctgtatataaaggaaatccgtacaatcatgcatgttccatgtatgaagcatct
agaaaatatcctttaatacaaataggtattcgtagcatggatatacttgaaaaaaaattc
cttcaaaaaggaaacgttttttatatgcatgaaatttataaaaacgatctatggatgaaa
aaagctattcaaaaactatcaaaaaatgtatttattagtatagatatagacgtttttgat
ccaagtataactccttctactggaactccagaacctggaggattggattggtatacaact
ttaagatttttcaaaaaagtttttcaaaaaaagaaaatcataggttttgatattgttgaa
cttttacccgacgaaaaagaatcctccacagattttttagctgttaaactttactataaa
ttactatcatataaatatgaattaactatatga

DBGET integrated database retrieval system