KEGG   Blattabacterium Bge (Blattella germanica): BLBBGE_098Help
Entry
BLBBGE_098        CDS       T00995                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoamide acyltransferase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bbl  Blattabacterium Bge (Blattella germanica)
Pathway
bbl00010  Glycolysis / Gluconeogenesis
bbl00020  Citrate cycle (TCA cycle)
bbl00620  Pyruvate metabolism
bbl01100  Metabolic pathways
bbl01110  Biosynthesis of secondary metabolites
bbl01120  Microbial metabolism in diverse environments
bbl01130  Biosynthesis of antibiotics
bbl01200  Carbon metabolism
Module
bbl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bbl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLBBGE_098 (aceF)
   00020 Citrate cycle (TCA cycle)
    BLBBGE_098 (aceF)
   00620 Pyruvate metabolism
    BLBBGE_098 (aceF)
Enzymes [BR:bbl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BLBBGE_098 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 PYNP_C
Motif
Other DBs
NCBI-ProteinID: ACY40130
UniProt: D0JAE2
Position
complement(100633..101811)
Genome map
AA seq 392 aa AA seqDB search
MAEIISMPQLSDTMEEGTVIKWNKKIGDQVSEGDILAEIETDKATQDFEIDVSGVLLFIG
VKEGGTTRVNDILAIIGEKGEDISHLISKSKGEEQEKKEIKEEKKDKVYKKNKKDRIFIS
PLAKKMAQKIGLSINDIKGSGEYGRIIKRDIESYEKTNEKTSYKEVNKKITHSSMRIKIA
KHLTYSKFSAPHYYLFSEINVDKLMKFRKDLNDKLSLEEKISFNDIIIKAVAQSLKRHPD
MNVSWNEEEILLHSHIHIGVAVAVKDGLIVPVIKNADQKSLLQISKEIKDKVLRSKSKKI
QPEEIENSTFTVSNLGMYGIEFFTSIINIPNSSILSVGSIMKRPIVKDSKIEIGNVMKIT
LSCDHRIIDGAIGSSYIHSLKNFLEDPITILF
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaataatatctatgccccaattaagtgatacaatggaagaggggactgtaata
aaatggaataaaaaaataggagatcaagtttcagaaggagatattctagctgaaatagaa
acagataaagcgactcaagattttgaaatagatgtaagtggagttttactttttattggg
gtaaaagaaggggggactacacgtgtaaatgatatattagcgattataggagagaaagga
gaagacatcagtcatttgatttcaaaatcaaaaggagaagaacaagaaaaaaaagaaatt
aaagaagaaaaaaaggataaagtatataaaaaaaataaaaaagatcgaatatttatttct
cctttagcaaaaaaaatggctcaaaaaataggactttctataaatgatattaaaggaagt
ggagaatatggaagaatcattaaaagagatattgaatcttatgaaaaaacaaatgaaaaa
acaagctataaggaagttaataaaaaaataactcattcttccatgagaataaaaatagca
aaacatttaacttattctaaattttctgctccacattattatttatttagtgaaattaat
gtggataaattgatgaaatttagaaaagacttaaacgataaactttctttagaagagaaa
atatcatttaatgatattattataaaagcggttgctcaatctttgaagaggcatcctgat
atgaatgtatcttggaatgaagaagagattctacttcattcacatattcatataggagta
gcagtagcggtaaaagatggattaattgtcccagttattaaaaatgcagatcaaaaatca
ttattacaaatttccaaagaaattaaagataaagtattacgttctaaatcaaaaaaaata
caaccagaagaaatagaaaacagtacttttacagtttccaatttgggaatgtatggaata
gaattttttacttctattattaacattcctaactcttctattttatctgtaggatctatt
atgaaacgaccaattgttaaagattctaaaatagaaataggaaatgtaatgaaaattact
ttatcttgtgatcatagaattatagatggagctataggaagtagctatattcattctctt
aaaaactttttagaagatcctattaccatactattttag

DBGET integrated database retrieval system