KEGG   Blattabacterium sp. (Blattella germanica): BLBBGE_102Help
Entry
BLBBGE_102        CDS       T00995                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bbl  Blattabacterium sp. (Blattella germanica)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bbl00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(105053..105883)
Genome map
AA seq 276 aa AA seqDB search
MTINCAGYLLHLKEPKVMGIVNLTPDSFYDGGKLDSESNLLKHVENLLNEGSDFIDIGGC
STRPKSKFITKEEEIKRVIKPIRTIIKNFPDIRISIDTFRSEVARIAVEEGVVMINDISG
GELDKNMFPLLGKLKIPYILNHMKGIPENMQEKPCYKHNIITEINNFFSKKFLFKKNGIQ
DIILDPGFGFGKTLEQNFQLLKHLSLLGFQDHLILIGISRKSMIKHLLKISHKESLNATS
VIHTIALLNGSKLLRVHDVKEAVECIKLVQYYRNIL
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgacaattaattgtgcaggatatttattacatttaaaagaaccaaaagttatgggaata
gtgaatctaactcctgattctttttatgatggagggaaattagattcagaatctaaccta
ttgaaacacgtagaaaatttattaaatgaaggttctgattttatagatattggaggttgt
tctactcgtccaaaatcaaaatttataacaaaagaagaagaaataaaaagagttataaaa
cctattcgtaccattataaaaaattttccagatattcgaatatctatagatacttttcgc
agcgaagtagctagaatagctgttgaagaaggagtcgtaatgatcaatgatatatcagga
ggggaattggacaaaaatatgtttcctttgcttgggaaactaaaaattccatatatatta
aatcatatgaaaggaattcctgaaaatatgcaagaaaaaccatgttataaacataacata
attacagaaattaataattttttttctaaaaaatttttatttaaaaaaaatggaattcaa
gatattatcctggatccaggatttggttttggaaaaacattagaacaaaattttcaatta
ttaaaacatttgtctttattgggatttcaagatcatttaattttaataggaatttctaga
aaatctatgataaaacatcttctaaaaatatctcataaagaatcattaaatgcgacttca
gtcatccatactatagcattattaaatggatcaaaattattgcgtgtacatgatgtaaaa
gaagcagtagaatgcattaaattggtacaatattacaggaatattttatga

DBGET integrated database retrieval system