KEGG   Blattabacterium sp. (Blattella germanica): BLBBGE_104Help
Entry
BLBBGE_104        CDS       T00995                                 

Gene name
tpiA
Definition
triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bbl  Blattabacterium sp. (Blattella germanica)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:bbl01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bbl01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bbl00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bbl00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
106456..107244
Genome map
AA seq 262 aa AA seqDB search
MFILELILIKMRKKIVIANWKMNHDFHETTNFLRNLLKIFLEKKINHNKEIIIAPSFPFL
HISNQILQGTTLKVAAQNIHQMDKGSYTGEVSASMLKSIGISKVILGHSERREFFIEKND
ILLKKIRIALKYEFHIIFCVGETAFERNQNQQFNIVKNQLKETVFHCSSDEIRFFYIAYE
PVWAIGTGKVATYEQAQTMHEFIRSLFLERYGESVSNKISILYGGSVNNLNAKALLLQKD
IDGGLVGNSSLKLEKFLEIIQS
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
ttgtttatattagaattaatattaataaaaatgaggaaaaagattgttattgcaaattgg
aaaatgaatcatgattttcatgaaacgactaattttcttagaaatttattgaaaattttt
ttagaaaaaaaaatcaatcataacaaagaaatcattattgctccttcttttcctttttta
catatttctaatcagattttacaaggaactactttaaaagtagctgctcaaaatattcat
caaatggacaaaggttcatacacaggcgaagtctcagcttctatgttaaaatctatagga
atttctaaagtgatattaggacatagtgaacgaagagagttttttattgaaaaaaatgat
attttattaaaaaaaataaggatagcattaaaatatgagttccatattattttttgtgta
ggggaaacggcttttgaaagaaatcaaaatcaacaattcaatattgtaaaaaatcaatta
aaagaaactgtttttcattgttcttcagatgaaattagatttttttatatagcatatgaa
ccagtatgggctattggaactggaaaagtggctacatatgaacaagctcaaacaatgcat
gaattcattcgttctttatttttggaaagatatggagaaagtgtttcaaataaaatatcc
attttgtatggaggaagtgtaaataatttgaatgcaaaagctcttcttttgcaaaaagac
atagatggaggtcttgtaggaaactcttctctaaaacttgaaaaatttttagaaattatt
caatcttga

DBGET integrated database retrieval system