KEGG   Blattabacterium Bge (Blattella germanica): BLBBGE_108Help
Entry
BLBBGE_108        CDS       T00995                                 

Gene name
rpsO
Definition
30S ribosomal protein S15
Orthology
K02956  
small subunit ribosomal protein S15
Organism
bbl  Blattabacterium Bge (Blattella germanica)
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:bbl00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    BLBBGE_108 (rpsO)
Ribosome [BR:bbl03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    BLBBGE_108 (rpsO)
  Bacteria
    BLBBGE_108 (rpsO)
  Archaea
    BLBBGE_108 (rpsO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(110408..110671)
Genome map
AA seq 87 aa AA seqDB search
MTAEKKKEIFKTYGTSVYDTGSSKAQVALFTYRINYLSNHLKNNKKDFNTERALVKLVGK
RKKLLKYIEKRDINSYKNIIKHLGLRK
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
atgacagcagagaaaaaaaaagaaatattcaaaacttacggaacgtccgtttacgataca
ggttcttcaaaagcacaagttgctttattcacttaccgtattaattatttaagcaatcat
ctgaaaaataataaaaaagattttaatacagaaagagctttggtaaaattggtaggaaaa
agaaaaaaactattaaaatatatagaaaaacgtgatattaatagttataaaaatataatt
aaacatctaggattgagaaaataa

DBGET integrated database retrieval system