KEGG   Blattabacterium Bge (Blattella germanica): BLBBGE_108Help
Entry
BLBBGE_108        CDS       T00995                                 

Gene name
rpsO
Definition
30S ribosomal protein S15
Orthology
K02956  
small subunit ribosomal protein S15
Organism
bbl  Blattabacterium Bge (Blattella germanica)
Pathway
Ribosome
Brite
KEGG Orthology (KO) [BR:bbl00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    BLBBGE_108 (rpsO)
Ribosome [BR:bbl03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    BLBBGE_108 (rpsO)
  Bacteria
    BLBBGE_108 (rpsO)
  Archaea
    BLBBGE_108 (rpsO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(110408..110671)
Genome map
AA seq 87 aa AA seqDB search
MTAEKKKEIFKTYGTSVYDTGSSKAQVALFTYRINYLSNHLKNNKKDFNTERALVKLVGK
RKKLLKYIEKRDINSYKNIIKHLGLRK
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
atgacagcagagaaaaaaaaagaaatattcaaaacttacggaacgtccgtttacgataca
ggttcttcaaaagcacaagttgctttattcacttaccgtattaattatttaagcaatcat
ctgaaaaataataaaaaagattttaatacagaaagagctttggtaaaattggtaggaaaa
agaaaaaaactattaaaatatatagaaaaacgtgatattaatagttataaaaatataatt
aaacatctaggattgagaaaataa

DBGET integrated database retrieval system