KEGG   Blattabacterium Bge (Blattella germanica): BLBBGE_289Help
Entry
BLBBGE_289        CDS       T00995                                 

Gene name
glmS
Definition
(GenBank) glutamine-fructose-6-phosphate transaminase (isomerizing)
  KO
K00820  glucosamine---fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
bbl  Blattabacterium Bge (Blattella germanica)
Pathway
bbl00250  Alanine, aspartate and glutamate metabolism
bbl00520  Amino sugar and nucleotide sugar metabolism
bbl01100  Metabolic pathways
bbl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bbl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BLBBGE_289 (glmS)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BLBBGE_289 (glmS)
Enzymes [BR:bbl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     BLBBGE_289 (glmS)
Peptidases [BR:bbl01002]
 Cysteine Peptidases
  Family C44
   BLBBGE_289 (glmS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SIS GATase_6 GATase_7 SIS_2 GATase_4
Motif
Other DBs
NCBI-ProteinID: ACY40310
UniProt: D0JAX2
Position
280192..282042
Genome map
AA seq 616 aa AA seqDB search
MCGIIGYLGYREAYPILINGLKKLEYRGYDSSGIAIFYENGYSLCKTKGRVDELEKKISY
DKIKITGTTGIGHTRWATHGIPNDLNAHPHVSNSNELIMIHNGIIENYHAIKIILSKNGF
TFKSKTDTEVLVNFIEYIKKENKFSLAEAVRISLNEIVGAYSIAIVDKSHPETIIIAKLG
SPLALGINEKEFFIASDPIPFIDYTKNAIYLKDGEMAILKKGKELDLRKIVNNHKLNPII
KKLKINLKQIEKGEYKYFMLKEIYEQPKTILDTLRGRLLISEGIICIDGIESNKDIFINA
KCITIVACGTSWHASLIGEYLLEELARIPVEVEYASEFRYRNPIIEKKDVIIVISQSGET
ADTLAALKLAKKKGAFVFGICNVVGSSIARSVDAGAYTHAGPEIGVASTKAFTAQITVLV
LLALKIGKHRSAINDSRYKYLCQELGSIPEKVDNALRIDNSIKKISKVYHNVNNFLYLGR
GINFPVALEGALKLKEISYIHAEGYPAAEMKHGPIALIDENMPVVIIATKKGCYNKIVGN
IQEIKARKGKIIAIVNEGDIQVSMLADHVIEVPEISEELSPLVTVIPLQLLAYQIAYIRG
ENVDQPRNLAKSVTVE
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtataattggttatttgggttatagagaagcttatcctattctcattaacgga
ttaaaaaaattggaataccgagggtatgatagttctggaattgccatattttatgaaaat
ggatatagtttgtgcaaaaccaaaggaagagttgatgaattggaaaaaaaaatatcttat
gacaagataaaaataactggaacaactggaataggtcatactagatgggcaacacatgga
attccaaatgatttgaatgctcatcctcatgtttctaattcaaatgaacttattatgatt
cataatggaatcatagaaaattatcatgcgattaaaatcattttgtcaaaaaatggtttt
acttttaaaagtaaaacagatacggaagtccttgttaattttattgaatatattaaaaaa
gaaaacaaattctctttagcagaagcggtaaggatttctttaaatgaaatagtaggagct
tattctattgctattgtagataaatcacatccagaaacgattatcattgccaaattgggg
agccctcttgcattgggaattaatgaaaaagaattttttattgcatctgatccgattcct
ttcatagattacacaaaaaatgctatttatttaaaagatggagaaatggctattcttaaa
aaaggaaaagaattagatcttagaaagattgtaaataatcataaactcaatccaatcatt
aaaaaacttaaaataaatttaaagcaaatagaaaaaggagaatataagtattttatgtta
aaagaaatatatgagcaaccaaaaacaattttagatacattacgtggtaggttattaatt
tcagaagggattatttgcattgacggaattgaatctaataaagatatttttattaatgct
aaatgtataactatagtagcttgtggaacttcatggcatgctagtttaattggagaatat
ctattagaagaacttgctcgtataccagtagaggtagagtatgcttccgaatttagatat
agaaatcctattatagagaaaaaagatgtaattatagtaatttctcaatcaggagaaaca
gctgatactttagcggctttaaaattagccaaaaagaaaggggcttttgtttttggaatt
tgtaatgtagtaggatcatccattgcacggagtgtagatgcgggagcttatactcacgca
ggtcctgaaattggagttgcgtctacaaaggcttttactgcacaaattacagttcttgtt
ttgttggctctaaagattggaaaacatagatccgctataaatgacagtcgttataaatat
ttgtgtcaggaacttggatcaattccagaaaaagttgataatgctttaagaatagataat
tctatcaaaaaaatttccaaagtatatcacaatgtaaacaattttctttatttaggcaga
ggtattaattttccagtcgctttagaaggagctttaaagttaaaagaaatatcttatatt
catgcagaaggttatcctgcagcagaaatgaaacatggccctattgctttgattgatgaa
aatatgccagtggttattattgcaacaaaaaaaggatgttataacaaaatagtaggcaat
attcaagaaattaaagctagaaaagggaaaattatagctatagttaatgagggtgatatt
caagtaagtatgttagctgatcacgtaattgaagtcccagaaatttctgaagaactcagt
ccattggttactgttattcctcttcaattattggcttatcaaatagcttatatacgagga
gaaaatgtagatcaaccaagaaatttagcaaaatcagtaacagtagaataa

DBGET integrated database retrieval system