KEGG   Blattabacterium sp. (Blattella germanica): BLBBGE_289Help
Entry
BLBBGE_289        CDS       T00995                                 

Gene name
glmS
Definition
glutamine-fructose-6-phosphate transaminase (isomerizing) (EC:2.6.1.16)
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
bbl  Blattabacterium sp. (Blattella germanica)
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bbl00520]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bbl00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
280192..282042
Genome map
AA seq 616 aa AA seqDB search
MCGIIGYLGYREAYPILINGLKKLEYRGYDSSGIAIFYENGYSLCKTKGRVDELEKKISY
DKIKITGTTGIGHTRWATHGIPNDLNAHPHVSNSNELIMIHNGIIENYHAIKIILSKNGF
TFKSKTDTEVLVNFIEYIKKENKFSLAEAVRISLNEIVGAYSIAIVDKSHPETIIIAKLG
SPLALGINEKEFFIASDPIPFIDYTKNAIYLKDGEMAILKKGKELDLRKIVNNHKLNPII
KKLKINLKQIEKGEYKYFMLKEIYEQPKTILDTLRGRLLISEGIICIDGIESNKDIFINA
KCITIVACGTSWHASLIGEYLLEELARIPVEVEYASEFRYRNPIIEKKDVIIVISQSGET
ADTLAALKLAKKKGAFVFGICNVVGSSIARSVDAGAYTHAGPEIGVASTKAFTAQITVLV
LLALKIGKHRSAINDSRYKYLCQELGSIPEKVDNALRIDNSIKKISKVYHNVNNFLYLGR
GINFPVALEGALKLKEISYIHAEGYPAAEMKHGPIALIDENMPVVIIATKKGCYNKIVGN
IQEIKARKGKIIAIVNEGDIQVSMLADHVIEVPEISEELSPLVTVIPLQLLAYQIAYIRG
ENVDQPRNLAKSVTVE
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtataattggttatttgggttatagagaagcttatcctattctcattaacgga
ttaaaaaaattggaataccgagggtatgatagttctggaattgccatattttatgaaaat
ggatatagtttgtgcaaaaccaaaggaagagttgatgaattggaaaaaaaaatatcttat
gacaagataaaaataactggaacaactggaataggtcatactagatgggcaacacatgga
attccaaatgatttgaatgctcatcctcatgtttctaattcaaatgaacttattatgatt
cataatggaatcatagaaaattatcatgcgattaaaatcattttgtcaaaaaatggtttt
acttttaaaagtaaaacagatacggaagtccttgttaattttattgaatatattaaaaaa
gaaaacaaattctctttagcagaagcggtaaggatttctttaaatgaaatagtaggagct
tattctattgctattgtagataaatcacatccagaaacgattatcattgccaaattgggg
agccctcttgcattgggaattaatgaaaaagaattttttattgcatctgatccgattcct
ttcatagattacacaaaaaatgctatttatttaaaagatggagaaatggctattcttaaa
aaaggaaaagaattagatcttagaaagattgtaaataatcataaactcaatccaatcatt
aaaaaacttaaaataaatttaaagcaaatagaaaaaggagaatataagtattttatgtta
aaagaaatatatgagcaaccaaaaacaattttagatacattacgtggtaggttattaatt
tcagaagggattatttgcattgacggaattgaatctaataaagatatttttattaatgct
aaatgtataactatagtagcttgtggaacttcatggcatgctagtttaattggagaatat
ctattagaagaacttgctcgtataccagtagaggtagagtatgcttccgaatttagatat
agaaatcctattatagagaaaaaagatgtaattatagtaatttctcaatcaggagaaaca
gctgatactttagcggctttaaaattagccaaaaagaaaggggcttttgtttttggaatt
tgtaatgtagtaggatcatccattgcacggagtgtagatgcgggagcttatactcacgca
ggtcctgaaattggagttgcgtctacaaaggcttttactgcacaaattacagttcttgtt
ttgttggctctaaagattggaaaacatagatccgctataaatgacagtcgttataaatat
ttgtgtcaggaacttggatcaattccagaaaaagttgataatgctttaagaatagataat
tctatcaaaaaaatttccaaagtatatcacaatgtaaacaattttctttatttaggcaga
ggtattaattttccagtcgctttagaaggagctttaaagttaaaagaaatatcttatatt
catgcagaaggttatcctgcagcagaaatgaaacatggccctattgctttgattgatgaa
aatatgccagtggttattattgcaacaaaaaaaggatgttataacaaaatagtaggcaat
attcaagaaattaaagctagaaaagggaaaattatagctatagttaatgagggtgatatt
caagtaagtatgttagctgatcacgtaattgaagtcccagaaatttctgaagaactcagt
ccattggttactgttattcctcttcaattattggcttatcaaatagcttatatacgagga
gaaaatgtagatcaaccaagaaatttagcaaaatcagtaacagtagaataa

DBGET integrated database retrieval system