KEGG   Blattabacterium Bge (Blattella germanica): BLBBGE_299Help
Entry
BLBBGE_299        CDS       T00995                                 

Gene name
asd
Definition
(GenBank) aspartate-semialdehyde dehydrogenase
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Organism
bbl  Blattabacterium Bge (Blattella germanica)
Pathway
bbl00260  Glycine, serine and threonine metabolism
bbl00261  Monobactam biosynthesis
bbl00270  Cysteine and methionine metabolism
bbl00300  Lysine biosynthesis
bbl01100  Metabolic pathways
bbl01110  Biosynthesis of secondary metabolites
bbl01120  Microbial metabolism in diverse environments
bbl01130  Biosynthesis of antibiotics
bbl01210  2-Oxocarboxylic acid metabolism
bbl01230  Biosynthesis of amino acids
Module
bbl_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
bbl_M00527  Lysine biosynthesis, DAP aminotransferase pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:bbl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLBBGE_299 (asd)
   00270 Cysteine and methionine metabolism
    BLBBGE_299 (asd)
   00300 Lysine biosynthesis
    BLBBGE_299 (asd)
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    BLBBGE_299 (asd)
Enzymes [BR:bbl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.11  aspartate-semialdehyde dehydrogenase
     BLBBGE_299 (asd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Semialdhyde_dhC Semialdhyde_dh Gp_dh_C
Motif
Other DBs
NCBI-ProteinID: ACY40317
UniProt: D0JAX9
Position
286595..287587
Genome map
AA seq 330 aa AA seqDB search
MKLGIVGVTGLVGRVMIDVLETKNFPLEELYLSASEKSVGKEFSFKEKKYKVISLHHLLL
KKPNIVLFSAGSDISKEWAPKFEKIGSIVIDNSSAWRMDPRKKLIVPEVNASFLDKRDKI
IANPNCSTIQLVMVLFPLHIEYKIQRVVISTYQSVTGTGKKALDQLNQEKEKNTNINKVY
PYSIYQNVLPHCDAFTENGYTMEEMKLIKETRKIMNDQNIAITATAVRVPVIGGHSESVN
ITFEKKPSIDRIYEILSKTRGIIVQDKPEKNIYPMPLYAHGKDEVFVGRIRKDFSFQNSV
NLWIVSDNLRKGAATNTIQIAEYLINKKYI
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaggaatagtaggagtaacagggttggtcggtcgtgttatgatagatgtttta
gaaacaaaaaattttccattggaggagttatatctttctgcttctgaaaaatctgtagga
aaagaattttctttcaaggaaaagaaatataaagttattagtttgcatcatttattgtta
aaaaaaccgaatattgttttattttcagcaggatcagatatctctaaagaatgggcacct
aaatttgaaaaaataggatcaatagttattgataattcttctgcatggagaatggatcct
agaaaaaaattaattgttcccgaagtgaatgcttcttttttggataaaagagataagatt
attgctaatccgaattgttctacaatacaattagtaatggttttatttccgttgcatata
gaatataaaattcagagagtagtaatttctacttatcaatcagtaacaggaaccggtaaa
aaagctttagatcaattaaaccaagaaaaagaaaaaaatacgaatataaataaagtctat
ccatattctatttatcaaaacgttttgcctcattgtgatgcttttacagaaaatggttat
actatggaagaaatgaaactcatcaaagaaacaagaaaaataatgaatgatcaaaacata
gctattactgctactgcagtacgtgttcctgttataggtggacattcagaaagtgtaaat
attacatttgaaaaaaaacctagtatagatcgtatatatgaaattttatctaaaacaaga
ggaattattgttcaagataaaccagaaaaaaatatttaccctatgccgttatatgctcat
ggaaaagatgaagtttttgttggaagaatacgaaaagatttttcatttcaaaattctgta
aatctttggatagtttctgataatttacgtaaaggagctgcaacaaacaccattcaaatt
gcagaatatttaataaataaaaaatatatttaa

DBGET integrated database retrieval system