KEGG   Blattabacterium Bge (Blattella germanica): BLBBGE_343Help
Entry
BLBBGE_343        CDS       T00995                                 

Gene name
tyrA
Definition
(GenBank) prephenate dehydrogenase
  KO
K04517  prephenate dehydrogenase [EC:1.3.1.12]
Organism
bbl  Blattabacterium Bge (Blattella germanica)
Pathway
bbl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bbl00401  Novobiocin biosynthesis
bbl01100  Metabolic pathways
bbl01110  Biosynthesis of secondary metabolites
bbl01130  Biosynthesis of antibiotics
bbl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bbl00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BLBBGE_343 (tyrA)
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    BLBBGE_343 (tyrA)
Enzymes [BR:bbl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.12  prephenate dehydrogenase
     BLBBGE_343 (tyrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDH NAD_binding_2 F420_oxidored 2-Hacid_dh_C Rossmann-like UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ACY40354
UniProt: D0JB16
Position
340455..341303
Genome map
AA seq 282 aa AA seqDB search
MNIGIIGLGLIGGSIGLGLKKSNFGDKIIGTDSNQENASHAVKLGIVDEIISLQDLIMQS
SVIILSIPVDGIEKILPIILNKISKDTVILDTGSTKYDICNRVSSHPKRSRFVATHPIAG
IENSGPISAHSDLFYKKNCIICDSERSDPDAMSIAKKIYSLMEMRMIYISSKEHDLYIAY
ISHLPHVVSFALASTVLKKFKNEEKIFHNMMGSGLDSTTRLAKSKPETWLPIFISNRENL
IQSIDFYIDYLEIFRNHLINKEFHKIDQYMKKANDIKDKKYV
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaatattggaataataggattagggttaataggtggatccattggtttgggattgaaa
aaatccaattttggagataaaattataggaacagattcaaatcaggagaacgcttcacat
gctgtgaaacttggaattgtagacgaaataatttctttgcaggatctcattatgcaatct
tcagtaattattttatctattcccgtagatggaatagaaaaaatacttccaattattctg
aataaaatcagtaaggatacagtgattttagatactggatctactaaatatgatatttgt
aatcgggtttcttctcatccgaaaagaagtcgatttgtagcgacacatcctattgcagga
attgaaaattctggacctatttcagctcattcagatcttttttataaaaaaaattgcatt
atttgtgattcggaacggagtgatccagatgcaatgtctattgcaaaaaaaatctattct
cttatggaaatgcggatgatttatatttcctctaaagaacatgatttatatattgcttat
atatctcatttacctcatgtagtttcctttgctttagctagtacagttttaaaaaaattt
aagaatgaagaaaaaatttttcataatatgatgggaagtggattagattcaacgacacgt
ttagcgaaaagtaagcctgaaacgtggttacctatttttatttctaatagagagaatctg
attcaatctatagatttttatattgattatttagaaatatttcgtaatcatttaataaat
aaagaatttcataagatcgatcaatacatgaaaaaggcgaacgatataaaagataaaaaa
tatgtgtaa

DBGET integrated database retrieval system