KEGG   Blattabacterium Bge (Blattella germanica): BLBBGE_346Help
Entry
BLBBGE_346        CDS       T00995                                 

Gene name
fabI
Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bbl  Blattabacterium Bge (Blattella germanica)
Pathway
bbl00061  Fatty acid biosynthesis
bbl00780  Biotin metabolism
bbl01100  Metabolic pathways
bbl01130  Biosynthesis of antibiotics
bbl01212  Fatty acid metabolism
Module
bbl_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bbl00001]
 Metabolism
  Lipid metabolism
   00061 Fatty acid biosynthesis
    BLBBGE_346 (fabI)
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BLBBGE_346 (fabI)
  Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosyntheses
    BLBBGE_346 (fabI)
Enzymes [BR:bbl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BLBBGE_346 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BLBBGE_346 (fabI)
Lipid biosynthesis proteins [BR:bbl01004]
 Fatty acid synthase
  Component type
   BLBBGE_346 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: ACY40357
UniProt: D0JB19
Position
343711..344511
Genome map
AA seq 266 aa AA seqDB search
MSYNLLKGKKGIIFGALDENSIAWKVAERAYEEKASFVLTNTPASLRIGKIHELSHKTKS
MVIPADATSISDLNILFEKTLGHFGGKIDFLLHSIAMSMNIRKGLTYPSLNYEFLRKGWE
ISAVSYHKMMQTAWKKKAMNKWGSIVALTYIASQRSFPYYGDMSDYKSYLESVTRNFGYY
WGIKEKVRVNTVSQSPSPTRAAKAIKGFDKFFLFSEKISPLGNASTQDCANYIITLFSDL
TRKVTMQNLYHDGGFSNTGISEAMIL
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgtcttacaatctattgaaaggaaaaaaaggaattatatttggagccttggatgaaaat
tctattgcttggaaggtagcagaacgtgcttatgaagaaaaagcatctttcgtattaact
aatacaccagcttctttaagaattggtaaaattcatgaattatctcacaaaacaaaatct
atggtaattccagcagatgccacttctatatcagatcttaatattttgtttgaaaaaaca
ttaggtcattttggaggaaaaatagattttttattgcattctatagctatgtctatgaac
atccgaaaaggattgacttatccctctctcaattatgaatttttaagaaaaggatgggaa
atatctgccgtatcttatcataagatgatgcaaacagcttggaaaaaaaaagcgatgaat
aagtggggttctattgtagctctaacatatattgcttctcaaagaagttttccatattat
ggagatatgtctgactataaatcttatttagaaagtgttacacgtaattttggttattat
tggggtatcaaagagaaggtaagggttaatactgtatcacagtctcctagtcccactaga
gcagcaaaagccatcaaaggttttgataaattttttcttttttcagaaaaaatatctcca
ttaggaaatgcttccacacaagattgtgccaactatataattacacttttttcagattta
acaagaaaagtaacaatgcaaaacttgtatcatgatggagggttttctaatactggaatt
agtgaagctatgattttataa

DBGET integrated database retrieval system