KEGG   Blattabacterium Bge (Blattella germanica): BLBBGE_350Help
Entry
BLBBGE_350        CDS       T00995                                 

Gene name
miaB
Definition
(GenBank) MiaB family tRNA modification enzyme: 2-methylthioadenine synthetase
  KO
K18707  threonylcarbamoyladenosine tRNA methylthiotransferase MtaB [EC:2.8.4.5]
Organism
bbl  Blattabacterium Bge (Blattella germanica)
Brite
Enzymes [BR:bbl01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.4  Transferring alkylthio groups
    2.8.4.5  tRNA (N6-L-threonylcarbamoyladenosine37-C2)-methylthiotransferase
     BLBBGE_350 (miaB)
Transfer RNA biogenesis [BR:bbl03016]
 Prokaryotic Type
  tRNA modification factors
   Methylthiotransferases
    BLBBGE_350 (miaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM UPF0004
Motif
Other DBs
NCBI-ProteinID: ACY40361
UniProt: D0JB23
Position
347830..349170
Genome map
AA seq 446 aa AA seqDB search
MMKKKVAFYTMGCKLNYAETSTIARKFSNLYYQHVPFKSYADIYVINSCSVTKNAEVEFR
HIVRSAMNQNSQAFIIAIGCYAQLNSKKVSSIVGVDLVLGSYEKFKITDYLDLELLKKSH
PKIISNAKTKNTYFPSFSVGDRTRSFLKIQDGCDYKCSYCIIPISRGASRSESIENILKN
IRLLFRNGVKEIVLTGVNIGDYGKKIYGENRRLYTFFDLIQAIDQIKEKGRIRLSSIEPN
LLKNECIEFLSKSKHFVPHFHIPLQSGSNDILGKMHRRYKRELYQEKVNKIRCFIPDAYI
GSDIIVGFPGETHKHFLETYHFLKKLEISSLHIFTYSPRPNTKSITLQGYVSKKIQWKRN
QILRNLSNKKYRFFCERQVYTKKTVLFEKNSTNQEYLYGYTENYIRTKIPLNSYNLSCYR
NTLQEVFITKIDQDGIMIAEPIQNYN
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaaaaaaagtagcattttatacaatggggtgtaaattgaattacgcagagacc
tctactatagcaagaaaattttctaatttatattatcaacatgttcctttcaaaagttat
gcagatatttatgtaatcaatagttgttctgttacaaaaaatgcagaagttgaatttagg
cacattgtacgttctgctatgaatcaaaattcacaagcttttattatagcaataggatgt
tatgctcaactgaattctaaaaaagtttcttctatcgttggagtagatctcgttttaggt
tcttacgaaaaattcaaaatcacagattatcttgatctagaattattgaaaaaatctcat
ccaaagattatttcaaatgcaaagacaaaaaatacttattttccatcgttttccgttgga
gatagaactcgttcttttttgaaaatacaggatggatgtgattataagtgtagctattgc
attattcccatatcaagaggggcctctcgttctgagagtatagaaaatatattgaaaaat
attaggcttctttttcgaaacggtgtgaaagaaatagttttaacaggtgttaatattgga
gattacggaaaaaaaatatatggagaaaatcgtcgtttatatacattttttgatttaata
caagctatagatcaaatcaaagaaaaaggaagaatacgtttatcttctatagaacctaat
ttattaaaaaatgaatgtattgaatttttgtctaaaagcaaacattttgttcctcatttt
catattcctttacaatctggaagcaacgatatattgggaaaaatgcatagacgttataaa
cgagaactttatcaagaaaaagtaaacaaaatccgatgtttcataccagatgcttatatc
ggttcagatattattgttgggtttcctggagaaacacataaacattttttggaaacttat
cattttttgaaaaaattagaaatttcatctctacacatatttacctattctcctagaccc
aatacaaaatctatcactctacagggatatgtttctaaaaaaatacaatggaaacggaat
caaattttgagaaatctttcaaacaaaaaatatcgttttttttgcgaaaggcaagtttac
acaaaaaaaaccgttttatttgaaaaaaattctacaaatcaagaatatttatatggatat
acagaaaattatattagaactaaaattccattgaattcatacaatttgtcatgttataga
aacacattacaagaagtgtttatcacaaaaatagaccaagatggaattatgatagcagaa
cctatacagaactataactga

DBGET integrated database retrieval system