KEGG   Blattabacterium Bge (Blattella germanica): BLBBGE_353Help
Entry
BLBBGE_353        CDS       T00995                                 

Definition
(GenBank) hypothetical protein BLBBGE_353
Organism
bbl  Blattabacterium Bge (Blattella germanica)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: ACY40364
UniProt: D0JB26
Position
complement(351480..352481)
Genome map
AA seq 333 aa AA seqDB search
MDFQYLKKNRLKMNPKKIFIEKVKEKGGWVNAHAHLDRAYTLTKKNFKYSYSSLKKKWYL
VDEMKRLATVEDIYIRMEKALEYFLMQGTQALCTFIDVDEIIEDRALKAAKKLKRNYENS
IHICFANQVLKGVLDKKSKYWFDKSVEFVDIIGGLPAKDYGKEDEHLDILLKTAKKKGKI
VHVHVDQFNTSEEKETEKLAKKTIEHGMQGKVVAIHSISLAAHARAYRYKTYQLMKKADL
MVISCPIAWIDHTRSERLTPSHNSITPVDEMVPEGIIVAFGTDNICDIYKPFSDGNLWIE
LRVMLEACHYYDIDHLVEIATINGLRVLGLVNK
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
ttggatttccaatatttaaaaaaaaaccgattgaaaatgaatcctaaaaaaatttttata
gagaaagtgaaagaaaaaggaggatgggtaaatgctcatgctcacttagatagggcttat
actctaacaaaaaaaaatttcaaatattcttattcttcactcaaaaaaaaatggtatctg
gttgatgaaatgaaacgtttagcgacagtagaggatatttatattcgtatggaaaaagct
ttggaatattttttaatgcaaggaacacaagctttgtgcacctttattgatgtggatgaa
attattgaagaccgtgccttgaaagccgctaaaaaattgaaaaggaattatgaaaattcc
atccatatttgttttgccaatcaagttttgaaaggagtattggacaagaagtcaaaatat
tggtttgataaatcagtagaattcgtggatataattggtggattacccgctaaagattat
ggaaaagaagatgaacatctagatattttattaaaaacagctaaaaaaaaaggaaaaata
gtccatgtccatgttgatcaatttaatactagcgaagaaaaagaaactgaaaaattagca
aaaaaaacgattgaacatggaatgcaaggaaaagtagtcgccatacatagtatttcttta
gcagcacatgctagagcttatcgttataaaacatatcaattaatgaaaaaagcagattta
atggtcatttcttgtcccatagcttggattgatcataccagaagtgaacgtttgactcct
agtcataattccatcactccagtagatgaaatggttcctgaaggaatcattgtggctttt
ggaacagataacatttgtgatatttacaaacctttttcggatggaaatctatggatagaa
ttacgtgtcatgttagaagcttgtcattattatgatatagatcatttagtagaaattgct
acaatcaacggattaagagtattaggattagtcaataaataa

DBGET integrated database retrieval system