KEGG   Blattabacterium Bge (Blattella germanica): BLBBGE_361Help
Entry
BLBBGE_361        CDS       T00995                                 

Definition
(GenBank) tRNA-pseudouridine synthase I
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
bbl  Blattabacterium Bge (Blattella germanica)
Brite
Enzymes [BR:bbl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     BLBBGE_361
Transfer RNA biogenesis [BR:bbl03016]
 Eukaryotic Type
  tRNA modification factors
   Psudouridine synthases
    BLBBGE_361
 Prokaryotic Type
    BLBBGE_361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TruB_N TruB_C_2
Motif
Other DBs
NCBI-ProteinID: ACY40370
UniProt: D0JB32
Position
complement(357463..358176)
Genome map
AA seq 237 aa AA seqDB search
MIKDLLEFQNGKILLIDKPWGWTSFEIVKKIKSFILTTIPKKGNLKIGHAGTLDPLATGL
LIILTGKYTKKVDDIQNYKKTYTGIIKLGCETLSFDSETEEYNFSSISHITPQLIRKTSQ
KFVGEIDQYPPSFSALKTKGKRFYEYARKGEKINSMKSRRVKIYQFHILKIGIPYIKFFI
ECGKGTYIRSVAQDFGKALKSGGYLLSLRRERIGNFSINDLESHLSIKLEFPCYLLN
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
ttgatcaaagatttattagaattccaaaatggaaaaatattattaatagataaaccctgg
ggatggacttcttttgaaattgttaaaaaaattaaaagttttattctcacgactattcca
aaaaaaggaaatttaaaaataggacacgcaggaactttagatcctcttgctacaggttta
ttaattattcttacaggaaaatatactaaaaaagtagatgatattcaaaattataaaaaa
acttatacaggaattatcaaattaggctgtgaaactttgtcttttgattcagaaacagag
gaatataatttttcttctatttcgcacatcactcctcaactgattagaaaaacatctcaa
aaatttgtgggagaaatcgatcaatatcctccctctttttctgccttaaaaacaaaagga
aaaagattctatgaatatgctagaaaaggagaaaaaatcaattccatgaagtctagacgt
gtaaaaatttatcaatttcatattctaaaaataggaattccctacataaaattttttata
gaatgtggaaaaggcacttatattagatctgttgcccaagattttggaaaagcactcaaa
agcggaggctatcttctttctttaagaagagaacgcatagggaatttttctataaatgat
ctagaatcccatctttcaatcaaattagaatttccatgttacttactaaattaa

DBGET integrated database retrieval system