KEGG   Blattabacterium sp. (Blattella germanica): BLBBGE_367Help
Entry
BLBBGE_367        CDS       T00995                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA (EC:3.1.22.4)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bbl  Blattabacterium sp. (Blattella germanica)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bbl03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
364508..365098
Genome map
AA seq 196 aa AA seqDB search
MITHLRGKLIEKNQSYLIIDCHGVGYHIHISLYTHSSLLEEEGKDICIHTYLFIKDNQHV
LYGFFDKIERKIFSYLISVNGIGPSSAIMLLSSLTPYEIEKSISKEDIKAFDKVKGIGTK
TAQRIIIELKDKFTKEIFYKKVKNENTPYSIKKEALSALSVLGFSTKESKKILDDILNEH
PEFSVENLIKESLKKL
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
gtgataacacatttaagaggaaagttaatagaaaaaaatcaatcttatttaataatagat
tgtcatggagtaggatatcatattcatatttcattatacacccattcttctttgttagaa
gaagaaggaaaagatatatgtatacatacttatctttttataaaagacaatcaacatgtt
ttgtatggtttttttgacaaaatagagagaaaaatattttcttatttgatatccgtgaat
ggaataggtccaagttctgctatcatgttattatcttctctgactccatatgaaatagaa
aaatctatatctaaagaagatataaaagcatttgacaaagttaaaggaattgggacaaaa
acagctcaaagaattattattgaattaaaagataaatttactaaagaaattttttataaa
aaagtaaaaaacgaaaacacaccttattcaatcaaaaaagaagctttaagtgctttgagc
gtacttggattttctactaaagaatctaaaaagattttggatgatattttgaatgaacat
ccagaattttctgtagaaaatctcattaaagaatctttgaaaaaattatga

DBGET integrated database retrieval system