KEGG   Blattabacterium Bge (Blattella germanica): BLBBGE_378Help
Entry
BLBBGE_378        CDS       T00995                                 

Gene name
mrp
Definition
(GenBank) Mrp/Nbp35 family ATP-binding protein
  KO
K03593  ATP-binding protein involved in chromosome partitioning
Organism
bbl  Blattabacterium Bge (Blattella germanica)
Brite
Chromosome and associated proteins [BR:bbl03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    BLBBGE_378 (mrp)
Mitochondrial biogenesis [BR:bbl03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-I assembly factors
    BLBBGE_378 (mrp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ParA CbiA AAA_31 ArsA_ATPase MipZ Fer4_NifH CLP1_P RsgA_GTPase APS_kinase FeS_assembly_P VirC1 AAA_25 RNA_bind_2 Ubie_methyltran NB-ARC CBP_BcsQ
Motif
Other DBs
NCBI-ProteinID: ACY40387
UniProt: D0JB49
Position
complement(373692..374702)
Genome map
AA seq 336 aa AA seqDB search
MKKKIEKALENVFIIDNQKNIIESGFVKKIDLLSHKIVIYLSLSNPAMHFKNKLIKDITH
SIKNQNISDPICIKIEMKSDPKIKPVIKNIIAVASGKGGVGKSTIATNIAVSLVKMGFHV
GLLDADIYGPSIPLMFNLEEVDIHTKIHKNGMMNPIMSYGVKILSIGFFSKYGQAIVWRG
PMVTKVLRQFIHETDWGKLDFLIVDLPPGTGDIHLSLLQEISLKGIVIVSTSQKIALSDV
NRSVGMFRIQSISVPILGIIENMSYVLTKESKEKCYFFGKNGVKNFSKKMNLFFLGEIPM
LQEIRKYSDLGIPGVLKNDKIKNIFLKITRNIINQL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaaaattgaaaaagcattagaaaatgtttttattattgataatcagaaaaat
attattgaatctggttttgtaaaaaagatagatttattgagtcataaaatagtaatctat
ttgagtttatctaatcccgctatgcatttcaaaaataaactaataaaagatataacccat
tctataaaaaatcaaaatatatcagatccaatatgtataaaaatagaaatgaaatcagat
cctaaaatcaaacctgtaataaaaaacataatagctgtagcttctggaaagggaggagtt
ggaaaatctacaatagcaactaatatagctgtatctttagtaaaaatgggttttcatgtt
ggattattggatgcggatatatatggaccttctattccattaatgtttaatctagaagaa
gtagatatccatacaaaaatacataaaaatggtatgatgaatcctattatgagttatgga
gtaaaaattctatctataggttttttttccaaatatggacaagctattgtttggagaggg
cctatggtcactaaagttttgagacaatttattcatgaaacggattggggaaagttagat
tttttaattgtagatttaccaccaggaacaggggatatacatttatctcttttgcaagag
atttcattaaaaggaattgttatagttagtacatctcaaaaaatagcgttatcggatgta
aacaggtcagtaggaatgtttcgtattcaatctatttctgttccaattcttggaattata
gaaaatatgtcttatgttcttacaaaagaaagtaaagaaaaatgttatttttttggaaaa
aatggagtcaaaaatttttccaaaaaaatgaatctttttttccttggagaaattcctatg
ttacaggaaatacgaaaatattcagatttgggaattcctggggttttaaaaaacgataaa
attaaaaatatttttctaaaaattacaagaaatattataaatcaattatag

DBGET integrated database retrieval system