KEGG   Blattabacterium Bge (Blattella germanica): BLBBGE_379Help
Entry
BLBBGE_379        CDS       T00995                                 

Definition
(GenBank) putative 4'-phosphopantetheinyl transferase superfamily protein
Organism
bbl  Blattabacterium Bge (Blattella germanica)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACPS
Motif
Other DBs
NCBI-ProteinID: ACY40388
UniProt: D0JB50
Position
374775..375413
Genome map
AA seq 212 aa AA seqDB search
MDFYPYKFYNLHTKIIVFRWVRWEHFLENMFLEKRILSDKEKMFFLSLSEKRKREFLGIR
YALRYIGMKMNIFYNEKRKPFLFSEGKYISLSHSFEKIAIAISSYHIGIDIEKLRHKIVK
IKKKFLREDESIFINPNYEEDYLHIIWGIKESLYKLEGGIFYSFLDHYKVSPFCLKKDSC
ISCWIIKKTYSKKYSAFYRKIEEHYLVYIIDK
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggatttttatccctataaattttataaccttcatacaaagattatagtttttagatgg
gttagatgggaacattttttagaaaacatgtttctagaaaagcgaattctttccgataaa
gaaaaaatgttttttttatctttatcggaaaaacgaaaaagagaatttttaggaattcgt
tatgctctgagatatataggcatgaaaatgaatattttttataatgaaaaaagaaaacct
tttcttttttctgaaggaaaatatatttccttaagtcattcttttgaaaaaattgccata
gctataagttcttaccatataggaatagatatagaaaaattacgacataaaatagttaaa
ataaagaaaaaatttcttagagaagatgaatctatttttattaatccaaattatgaagag
gattatctgcatatcatatggggaattaaagaaagtttgtacaaattagaaggtggtatt
ttttatagttttttagatcattataaagtttctcctttttgccttaaaaaagattcttgc
atatcatgctggattataaaaaaaacctatagtaagaaatattctgctttttatcgaaaa
atagaagaacattacttagtttatattatagataaatga

DBGET integrated database retrieval system